We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 8D2Z | 2023 | 0 |
| 8D57 | 2022 | 0 |
| 7TXX | 2022 | 0 |
| 8DF5 | 2022 | 0 |
| 7TWZ | 2022 | 0 |
| 4POB | 2014 | 0 |
| 4PPW | 2014 | 0 |
| 8DGD | 2023 | 0 |
| 8DIM | 2022 | 0 |
| 7TOT | 2022 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 3rd5 | - | http://search.proquest.com/openview/3456a0f162d24a094672122e01905158/1?pq-origsi... | Mechanistic Studies on the Light-Dependent NADPH: Protochlorophyllide Oxidoreductase and Animal Cryptochromes | 2018 | N Archipowa - 2018 - search.proquest.com | a C15-E-anti-configuration as shown in Figure 1.4A [8]. This is followed by formation. of several thermally activated intermediates comprising structural changes of the POR. Crystal structure of the NB-protein catalytic site ( PDB : 3AEK [32]). The |
| 2 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 3 | 3h7f | - | https://link.springer.com/chapter/10.1007/978-3-030-18375-2_12 | Combinatorial Designing of Novel Lead Molecules Towards the Putative Drug Targets of Extreme Drug-Resistant Mycobacterium tuberculosis: A Future Insight for | 2019 | N Bachappanavar, S Skariyachan- Essentials of Bioinformatics, Volume II, 2019 - Springer | glyoxylate and dicarboxylate. The native structure of serine hydroxymethyltransferase ( PDB ID: 3H7F ) possessed two chains (A and B) with molecular weight of 95226.08 Da and a resolution of 1.5 (R-value free, 0.196) (Fig. 12.2a). Further |
| 4 | 4f3p | - | https://www.sciencedirect.com/science/article/pii/S0141813018328228 | Local structural motifs in proteins: Detection and characterization of fragments inserted in helices | 2018 | N Balasco, G Smaldone, A Ruggiero- International journal of, 2018 - Elsevier | insertion: A) the substrate binding proteins ( PDB IDs: 1GGG, 1HLS, 1IIT, 2IEE, 2YLN, 4EQ9, 4F3P , 4H5F, 4I62 in red, 3QFH in blue), and C) the elongation factors EF-1A/EF-Tu ( PDB IDs: 1EFC In particular, they could (a) present an irregular loop structure , (b) form -hairpins or |
| 5 | 4gri | 4g6z | http://www.bioscirep.org/content/35/2/e00184.abstract | Dispensability of zinc and the putative zinc-binding domain in bacterial glutamyl-tRNA synthetase | 2015 | N Chongdar, S Dasgupta, AB Datta, G Basu - Bioscience reports, 2015 - bioscirep.org | ... From extensive structural and sequence analyses from whole genome database of bacterialGluRS, we further show that in addition to many bacterial GluRS lacking a zinc-binding motif,the pZBD is actually deleted in some bacteria, all containing either glutaminyl-tRNA ... |
| 6 | 4g6z | 4gri | http://scripts.iucr.org/cgi-bin/paper?S2053230X14010723 | Preliminary X-ray crystallographic analysis of an engineered glutamyl-tRNA synthetase from Escherichia coli | 2014 | N Chongdar, S Dasgupta, AB Datta - Section F: Structural , 2014 - scripts.iucr.org | ... S. & Yokoyama, S. (2010). Acta Cryst. D66, 813-820.] ). In addition, crystal structures of GluRS from Burkholderia thailandensis (PDB entry 4g6z ; Baugh et al., 2013 [Baugh, L. et al. (2013). PLoS One, 8, e53851.] ) and Borrelia ... |
| 7 | 3gka | - | http://www.teses.usp.br/teses/disponiveis/76/76132/tde-24032014-151614/en.php | Estudo estrutural das enzimas Topoisomerase II Mitocondrial e Old Yellow Enzyme de Trypanosoma cruzi | 2014 | NC Rodrigues - teses.usp.br | ... resolution of 1.27 and 2.00 , respectively. The atomic coordinates and structure factors of the TcOYE structure in P212121 and P21 crystalline forms have been deposited in the Protein DataBank with the accession codes 4E2B and 4E2D, respectively. TcOYE displays a ... |
| 8 | 4nps | - | https://www.pnas.org/content/118/12/e2023245118.short | Structural basis for selective AMPylation of Rac-subfamily GTPases by Bartonella effector protein 1 (Bep1) | 2021 | N Dietz, M Huber, I Sorg, A Goepfert- Proceedings of the, 2021 - National Acad Sciences | Skip to main content. Main menu. Home; Articles: Current; Special Feature Articles - Most Recent; Special Features; Colloquia; Collected Articles; PNAS Classics; List of Issues. Front Matter: Front Matter Portal; Journal Club. News: For |
| 9 | 3cxk | - | http://www.sciencedirect.com/science/article/pii/S0378111912014242 | Methionine sulfoxide reduction in ciliates: Characterization of the ready-to-use methionine sulfoxide-< i> R</i>-reductase genes in< i> Euplotes</i> | 2013 | N Dobri, EEN Oumarou, C Alimenti, C Ortenzi? - Gene, 2012 - Elsevier | ... The crystallographic structure of the Burkholderia pseudomallei MsrB (PDB ID: 3cxk) was automatically selected by the server as a template since it shows an amino acid sequence identity of 53% and 56% with the MsrB protein of E. raikovi and E. nobilii, respectively. ... |
| 10 | 4g5d | - | https://www.degruyter.com/document/doi/10.1515/chem-2024-0005/html | Anti-parasitic activity and computational studies on a novel labdane diterpene from the roots of Vachellia nilotica | 2024 | NF Al-Tannak, JV Anyam, EY Santali, AI Gray- Open, 2024 - degruyter.com | structure with proteins was retrieved from a protein data bank ( PDB ) with codes: 2P7U and 4G5D agents and a structural basis for drug design) ( structures of prostaglandin F synthase |