SSGCID
Seattle Structural Genomics Center for Infectious Disease

Cited Structures: list of articles citing SSGCID structures

We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.

This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.

Cited structures

Manually reviewed citations

# PDB Additional SSGCID structures cited Link Title Year Citation Highlighted abstract
1 3ek2 - https://opus.uni-wuerzburg.de/opus4-wuerzburg/files/7086/Thesis_MariaHirschbeck_... Structure-based drug design on the enoyl-ACP reductases of Yersinia pestis and Burkholderia pseudomallei 2012 MW Hirschbeck - opus.uni-wuerzburg.de ... In the PDB database an apo structure of BpFabI had already been deposited (PDB code 3EK2), which was crystallized in 10% PEG 6000 and 100 mM HEPES pH 7.0. ...
2 3r1i - http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3867646/ Insilico Characterization and Homology Modeling of Arabitol Dehydrogenase (ArDH) from Candida albican 2013 MW Sarwar, IB Saleem, A Ali, F Abbas - Bioinformation, 2013 - ncbi.nlm.nih.gov … used for multiple sequence alignment of ArDH with other dehydrogenases from Mycobacterium marinum (PDB Id: 3R1I), Candida parapsilosis ...
3 3urr - https://journals.asm.org/doi/abs/10.1128/jb.00023-23 All dacs in a row: domain architectures of bacterial and archaeal diadenylate cyclases 2023 MY Galperin- Journal of Bacteriology, 2023 - Am Soc Microbiol The search of the AlphaFold-predicted structure of DACNG using Dali (90) does not show any closely related structures in the PDB . This domain can also be found in a stand-alone ... PTS_EIIA_2 PF00359 139 3URR
4 3rd5 - http://search.proquest.com/openview/3456a0f162d24a094672122e01905158/1?pq-origsi... Mechanistic Studies on the Light-Dependent NADPH: Protochlorophyllide Oxidoreductase and Animal Cryptochromes 2018 N Archipowa - 2018 - search.proquest.com a C15-E-anti-configuration as shown in Figure 1.4A [8]. This is followed by formation. of several thermally activated intermediates comprising structural changes of the POR. Crystal structure of the NB-protein catalytic site ( PDB : 3AEK [32]). The
5 6c87 - https://www.sciencedirect.com/science/article/pii/S1878818119318249 In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family 2020 N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16
6 3h7f - https://link.springer.com/chapter/10.1007/978-3-030-18375-2_12 Combinatorial Designing of Novel Lead Molecules Towards the Putative Drug Targets of Extreme Drug-Resistant Mycobacterium tuberculosis: A Future Insight for 2019 N Bachappanavar, S Skariyachan- Essentials of Bioinformatics, Volume II, 2019 - Springer glyoxylate and dicarboxylate. The native structure of serine hydroxymethyltransferase ( PDB ID: 3H7F ) possessed two chains (A and B) with molecular weight of 95226.08 Da and a resolution of 1.5 (R-value free, 0.196) (Fig. 12.2a). Further
7 4f3p - https://www.sciencedirect.com/science/article/pii/S0141813018328228 Local structural motifs in proteins: Detection and characterization of fragments inserted in helices 2018 N Balasco, G Smaldone, A Ruggiero- International journal of, 2018 - Elsevier insertion: A) the substrate binding proteins ( PDB IDs: 1GGG, 1HLS, 1IIT, 2IEE, 2YLN, 4EQ9, 4F3P , 4H5F, 4I62 in red, 3QFH in blue), and C) the elongation factors EF-1A/EF-Tu ( PDB IDs: 1EFC In particular, they could (a) present an irregular loop structure , (b) form -hairpins or
8 3o0m 3oj7, 3r6f, 3lb5 https://udspace.udel.edu/items/40e2c554-f9dc-43a9-bb93-b6dd5914e73c Potential Binding Partners of cADPR and cADPR isomers in the Thoeris Phage Defense System 2023 N Bomasamudram - 2023 - udspace.udel.edu structures , and they differ based on their Cterminus. The structures of categorized Hint structures hydrocarbonoclasticus (3OHE), and Mycolicibacterium smegmatis ( 3O0M ). Type III Hint
9 4g6z 4gri http://scripts.iucr.org/cgi-bin/paper?S2053230X14010723 Preliminary X-ray crystallographic analysis of an engineered glutamyl-tRNA synthetase from Escherichia coli 2014 N Chongdar, S Dasgupta, AB Datta - Section F: Structural , 2014 - scripts.iucr.org ... S. & Yokoyama, S. (2010). Acta Cryst. D66, 813-820.] ). In addition, crystal structures of GluRS from Burkholderia thailandensis (PDB entry 4g6z ; Baugh et al., 2013 [Baugh, L. et al. (2013). PLoS One, 8, e53851.] ) and Borrelia ...
10 4gri 4g6z http://www.bioscirep.org/content/35/2/e00184.abstract Dispensability of zinc and the putative zinc-binding domain in bacterial glutamyl-tRNA synthetase 2015 N Chongdar, S Dasgupta, AB Datta, G Basu - Bioscience reports, 2015 - bioscirep.org ... From extensive structural and sequence analyses from whole genome database of bacterialGluRS, we further show that in addition to many bacterial GluRS lacking a zinc-binding motif,the pZBD is actually deleted in some bacteria, all containing either glutaminyl-tRNA ...