We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 8G0U | 2023 | 0 |
| 5I92 | 2016 | 0 |
| 8G0V | 2023 | 0 |
| 8SA7 | 2023 | 0 |
| 8SA8 | 2023 | 0 |
| 5IDY | 2016 | 0 |
| 5IF2 | 2017 | 0 |
| 5IF5 | 2017 | 0 |
| 5IF7 | 2017 | 0 |
| 5IF8 | 2017 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 4djt | - | https://dspace.cuni.cz/handle/20.500.11956/51825 | Existuj sekvenn determinanty funkn divergence GTPz? | 2017 | O Kraus - 2017 - dspace.cuni.cz | ... responsible for major functional differences between different protein families. To compare them,I have used the structural data from the PDB database and sequences from the UniProt database. ...protein structure on the example of small GTPases. The first results are not ... |
| 2 | 3ijp | - | http://search.proquest.com/openview/fe30810b9baec6939869fd9046280643/1?pq-origsi... | MOLECULAR MODELING AND DOCKING STUDIES OF DIHYDRODIPICOLINATE REDUCTASE ENZYME (DHDPR) OF STREPTOCOCCUS SUIS AND … | 2014 | ON Erick, MN Padmanabhan… - Advances in …, 2014 - search.proquest.com | ... The current study hypothesized to model structure for DapB gene encoding dihydrodipicolinatereductase enzyme ... et al., 1997 ; PDB:1VM6 (Joint Centre for Structural Genomics) and PDB:3IJP(Seattle Structural ... Structural and mutagenic analysis of relaxed nucleotide specificity. ... |
| 3 | 6nb6 | - | https://www.mdpi.com/2218-273X/10/9/1346 | Recognition of Potential COVID-19 Drug Treatments through the Study of Existing ProteinDrug and ProteinProtein Structures: An Analysis of Kinetically Active | 2020 | O Perii- Biomolecules, 2020 - mdpi.com | their binding free energies to the COVID-19 structural and non- structural protein sites The structure alignment, hydrophobicity calculation, visualization and analyses were performed with the programs Chimera each protein chain that forms a protein complex (given as a PDB file |
| 4 | 3d64 | - | http://www.sciencedirect.com/science/article/pii/S0925443912002165 | S-adenosyl-L-homocysteine hydrolase and methylation disorders: Yeast as a model system | 2013 | O Tehlivets, N Malanovic, M Visram… - … et Biophysica Acta (BBA …, 2013 - Elsevier | ... 1. AdoMet — a principal methyl group donor and more. Beyond its role in protein synthesisand structure, methionine, after its activation to AdoMet by methionine adenosyltransferase,plays a crucial role in many aspects of cellular metabolism. ... |
| 5 | 5ucm | - | https://www.sciencedirect.com/science/article/pii/S002192581750441X | Human trans-editing enzyme displays tRNA acceptor-stem specificity and relaxed amino acid selectivity | 2020 | O Vargas-Rodriguez, M Bakhtina, D McGowan- Journal of Biological, 2020 - Elsevier | Corrections to the resulting alignment were made based on the structural alignment of Cc ProXp-ala (Protein Data Bank entry 5VXB) and Pa ProRS (Protein Data Bank entry 5UCM). |
| 6 | 4g7f | 4lsm, 4fzi, 4iv5 | https://link.springer.com/content/pdf/10.1007/s10863-020-09834-8.pdf | Synthesis of new N,S-acetal analogs derived from juglone with cytotoxic activity against Trypanossoma cruzi | 2020 | PAF Pacheco, T de Menezes Ribeiro- Journal of Bioenergetics, 2020 - Springer | Naphthoquinones are considered important structures in medicinal chemistry due to their synthetic versatility and their v.1.0.1 program was used to build the molec- ular structure of ligands the best SI value among all molecules tested indicating that this structural feature might |
| 7 | 3uw3 | - | http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 | Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin | 2016 | P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com | A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ... |
| 8 | 3hhj | 4dyw | http://repositorio.udec.cl/handle/11594/1006 | Asociacin de genes nudA y htrA de Helicobacter pylori con severidad de patologas gstricas, estudio bioinformtico de la protena NudA. | 2019 | PA Lincoir Campos - 2019 - repositorio.udec.cl | Page 1. Universidad de Concepcin Direccin de Postgrado Facultad de Ciencias Biolgicas - Programa de Magister en Ciencias con Mencin en Microbiologa Asociacin de genes nudA y htrA de Helicobacter pylori con severidad de patologas gstricas |
| 9 | 3obk | - | https://www.sciencedirect.com/science/article/pii/S2468111320300372 | The Se S/N interactions as a possible mechanism of -aminolevulinic acid dehydratase enzyme inhibition by organoselenium compounds: a computational study | 2020 | PA Nogara, L Orian, JBT Rocha- Computational Toxicology, 2020 - Elsevier | Figure 1. (A) The structural formula of some organoselenium compounds, (B) the 5-aminolevulinic acid (5 theory (DFT) approach, are frequently used in the study of structures , reactions, and modeling has been successfully employed to predict the 3D protein structure , which is... (HEM2_STAAR); Toxoplasma gondii: PDB (3OBK); Wolbachia: NCBI (WP_041571452.1). |
| 10 | 3grk | - | http://www.opus4.kobv.de/opus4-fau/files/2717/Dissertation_PB_Unibib.pdf | Expression und Mutagenese von VEP1-kodierten Progesteron-5β-Reduktasen aus pharmazeutisch interessanten Angiospermen | 2012 | P Bauer - 2012 - opus4.kobv.de | ... Parallel wurden mit Hilfe der „Superposition“-Funktion der Wincoot Software (II.2.5) in silico die Cosubstrat-Bindetasche der DlP5βR jeweils mit der von verschiedenen NADHabhängigen SDR-Enzymen überlagert (PDB: 2ztl, 3d3w, 3grk,.. |