We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 5HGW | 2016 | 0 |
| 5HL6 | 2016 | 0 |
| 5HSX | 2016 | 0 |
| 8FUY | 2023 | 0 |
| 8G0R | 2023 | 0 |
| 4H3Y | 2012 | 0 |
| 8G0U | 2023 | 0 |
| 5I92 | 2016 | 0 |
| 8G0V | 2023 | 0 |
| 8SA7 | 2023 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 3d64 | - | http://www.sciencedirect.com/science/article/pii/S0925443912002165 | S-adenosyl-L-homocysteine hydrolase and methylation disorders: Yeast as a model system | 2013 | O Tehlivets, N Malanovic, M Visram… - … et Biophysica Acta (BBA …, 2013 - Elsevier | ... 1. AdoMet — a principal methyl group donor and more. Beyond its role in protein synthesisand structure, methionine, after its activation to AdoMet by methionine adenosyltransferase,plays a crucial role in many aspects of cellular metabolism. ... |
| 2 | 5ucm | - | https://www.sciencedirect.com/science/article/pii/S002192581750441X | Human trans-editing enzyme displays tRNA acceptor-stem specificity and relaxed amino acid selectivity | 2020 | O Vargas-Rodriguez, M Bakhtina, D McGowan- Journal of Biological, 2020 - Elsevier | Corrections to the resulting alignment were made based on the structural alignment of Cc ProXp-ala (Protein Data Bank entry 5VXB) and Pa ProRS (Protein Data Bank entry 5UCM). |
| 3 | 3jst | - | https://www.sciencedirect.com/science/article/pii/S0141813020335261 | Role of tetrachloro-1, 4-benzoquinone reductase in phenylalanine hydroxylation system and pentachlorophenol degradation in Bacillus cereus AOA-CPS1 | 2020 | OA Aregbesola, A Kumar, MP Mokoena- International Journal of, 2020 - Elsevier | Three-dimensional structure and homology modelling of the protein were predicted by submitting the amino acid sequence at the SWISS-MODEL tool at The modelled PDB files were submitted to an online tool (PDBsum) for determining the structural summary [34]. 2.12 ... and sequence identity of 59%, followed by PCD/DCoH (PDB: 3JST) from Brucella melitensis, |
| 4 | 6wps | - | https://www.nature.com/articles/s41598-020-71748-7 | Analysis of the SARS-CoV-2 spike protein glycan shield reveals implications for immune recognition | 2020 | OC Grant, D Montgomery, K Ito, RJ Woods- Scientific reports, 2020 - nature.com | The 3D structures show that the protein surface is extensively shielded from antibody recognition by glycans, with the notable exception of the ACE2 receptor Here we examine the structure of the SARS-CoV-2 envelope spike (S) protein that mediates host cell infection, with a. ... However, a closer examination also indicates a contraction between the 3D glycoform model and the observed binding of the neutralizing antibody S309 (PDB ID 6WPS). |
| 5 | 3dmp | - | https://arxiv.org/abs/2111.07786 | Independent SE (3)-Equivariant Models for End-to-End Rigid Protein Docking | 2021 | OE Ganea, X Huang, C Bunne, Y Bian- arXiv preprint arXiv, 2021 - arxiv.org | the 3D structure of a protein-protein complex from the individual unbound structures , of the initial locations and orientations of the two structures . Our model, named EQUIDOCK, |
| 6 | 3ijp | - | http://search.proquest.com/openview/fe30810b9baec6939869fd9046280643/1?pq-origsi... | MOLECULAR MODELING AND DOCKING STUDIES OF DIHYDRODIPICOLINATE REDUCTASE ENZYME (DHDPR) OF STREPTOCOCCUS SUIS AND … | 2014 | ON Erick, MN Padmanabhan… - Advances in …, 2014 - search.proquest.com | ... The current study hypothesized to model structure for DapB gene encoding dihydrodipicolinatereductase enzyme ... et al., 1997 ; PDB:1VM6 (Joint Centre for Structural Genomics) and PDB:3IJP(Seattle Structural ... Structural and mutagenic analysis of relaxed nucleotide specificity. ... |
| 7 | 3uw3 | - | http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 | Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin | 2016 | P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com | A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ... |
| 8 | 3grk | - | http://www.opus4.kobv.de/opus4-fau/files/2717/Dissertation_PB_Unibib.pdf | Expression und Mutagenese von VEP1-kodierten Progesteron-5β-Reduktasen aus pharmazeutisch interessanten Angiospermen | 2012 | P Bauer - 2012 - opus4.kobv.de | ... Parallel wurden mit Hilfe der „Superposition“-Funktion der Wincoot Software (II.2.5) in silico die Cosubstrat-Bindetasche der DlP5βR jeweils mit der von verschiedenen NADHabhängigen SDR-Enzymen überlagert (PDB: 2ztl, 3d3w, 3grk,.. |
| 9 | 6vxx | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7505244/ | Comparative molecular docking analysis of the SARS CoV-2 Spike glycoprotein with the human ACE-2 receptors and thrombin | 2020 | P Bhanu, NH Kumar, SH Kumar, M Relekar- , 2020 - ncbi.nlm.nih.gov | PDB ID, Ligand, Binding Pose, Binding Energy (Kcal/mol), RMSD, Receptor, Bond Length ( Figure 1a: Structural representation of 6VXX and thrombin, Figure 1b: Molecular interaction of with the 7th pose, Key - the sticks represents thrombin, the secondary structure represents the |
| 10 | 3uam | - | http://122.252.232.85:8080/jspui/bitstream/123456789/16590/1/131812%2C131520.pdf | Structural Dynamics of Lytic PolysaccHaride Monooxygenase | 2017 | P Bharval, S Sarswati, RM Yennamalli - 2017 - 122.252.232.85 | (a) For AA9 the reference structure is 2bem, (b)For AA10 the reference structure is 2bem (c) For AA11 the reference structure is 4MAH PDB ID RMSD 2BEN 0.303 2LHS 1.273 2XWX 0.491 2YOW 0.445 2YOX 0.474 2YOY 0.440 3UAM 0.700 4A02 0.880 4ALC 0.673 |