We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 6AP5 | 2017 | 0 |
| 6ANZ | 2017 | 0 |
| 8SQP | 2023 | 0 |
| 8SQO | 2023 | 0 |
| 8SOY | 2023 | 0 |
| 8SNJ | 2023 | 0 |
| 8SNG | 2023 | 0 |
| 8SLH | 2023 | 0 |
| 5VPS | 2017 | 0 |
| 5VO7 | 2017 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 3v7o | 5dvw | https://www.intechopen.com/books/ebola/strategies-for-the-development-of-small-m... | Strategies for the Development of Small Molecule Inhibitors of Ebola Viral Infection | 2016 | S Pleko, Podlipnik - Ebola, 2016 - intechopen.com | ... 2. Structure and action of Ebola virus. ... PDB structures: 2i8b, 3v7o, 5dvw, Target basic patcharound LYS 180 to inhibit the activation of transcription. ... PDB structures: 3vne, 3vnf, 4d9o,4m0q, 4or8, 4u2x, Inhibition of VP24 binding to karyopherin. ... |
| 2 | 3rmi | - | https://uwc-usa.academia.edu/Bar%C4%B1%C5%9FEkim/Drafts | A novel entropy-based hierarchical clustering framework for ultrafast protein structure search and alignment | 2016 | B Ekim - academia.edu | ... Four uncharacterized proteins (1IVZ, 3B4Q, 3DDE, and 4RGI) and their closest structural neighbors (2E7V, 3RMI, 3HLX, and 5BV3, respectively), printed as output by Esperite (Cosine distance between any one of the pairs were 0.0), and to be investigated further through protein nuclear magnetic resonance spectroscopy. ... |
| 3 | 4h51 | 4w5k, 3meb | http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0158402 | Structural Insights into a Novel Class of Aspartate Aminotransferase from Corynebacterium glutamicum | 2016 | HF Son, KJ Kim - PloS one, 2016 - journals.plos.org | ... A) RMSD of reported AspAT structures were analyzed. PDB code 1SPA; Escherichia coli, 7AAT; Gallus gallus (cytosolic), 2CST; Gallus gallus (mitochondrial), 3PD6; Mus musculus, 4W5K; Trypanosoma brucei, 1AJR; Sus scrofa, 3MEB; Gaiardia lamblia, 1YAA; Saccharomyces cerevisiae, 4H51; Leishmania major, 3K7Y; Plasmodium falciparum, ... |
| 4 | 3ftp | 3f9i, 3grp | http://jb.asm.org/content/198/3/463.short | Dissecting the structural elements for the activation of -ketoacyl-(acyl carrier protein) reductase from Vibrio cholerae | 2016 | J Hou, H Zheng, M Chruszcz - Journal of , 2016 - Am Soc Microbiol | ... All enzymes in the active state (shown in gray with PDB accession numbers 1Q7B, 1UZN, 2C07, 2P68, 2UVD, 3FTP, 3LYL, 3OP4, 3RRO, 3OSU, and 4AFN) share the same open conformation in the cofactor binding site, while all the enzymes in the inactive state (shown in blue with PDB accession numbers 1I01, 1UZL, 2NTN, 3F9I, 3GRP, and 3TZC) have disordered ... |
| 5 | 3uw3 | - | http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 | Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin | 2016 | P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com | A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ... |
| 6 | 3k9w | - | http://ir.inflibnet.ac.in:8080/jspui/bitstream/10603/184372/13/13_refernces.pdf | Structural and functional characterization of type three secretion associated proteins from Yersinia enterocolitica and vitamin biosynthesis pathway proteins from | 2016 | R Chatterjee - 2016 - ir.inflibnet.ac.in | Crystal structures of homologues of SycB from PDB (SycD[2VGX], IpgC[3- GYZ], PcrH[2XCC]) showed that Consensus server of secondary structure prediction showed that SycB has 75.7% of helix and rest of Expression, Purification, Structural and Functional Analysis of SycB |
| 7 | 4o3v | 4nhf, 4lso, 4kz1 | http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4840375/ | VirB8-like protein TraH is crucial for DNA transfer in Enterococcus faecalis | 2016 | C Fercher, I Probst, V Kohler - Scientific , 2016 - ncbi.nlm.nih.gov | ... A structure-based homology search revealed that TraH is related to proteins of the VirB8 family,which all exhibit a ... PDB code 4NHF, 14% sequence identity), Bartonella quintana (PDB code 4LSO,6% sequence identity), Rickettsia typhi (PDB code 4O3V, 19% sequence ... |
| 8 | 3oxk | - | http://scripts.iucr.org/cgi-bin/paper?hv9323 | Response to Errors in Crystal structure of HINT from Helicobacter pylori | 2016 | KF Tarique, S Devi, SA Abdul Rehman - Section F: Structural , 2016 - scripts.iucr.org | ... The confusion arises again from the various PDB entries where the same protein was namedas ... branch of the HIT family (http:// www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv ... has also beenidentified to contain purine nucleoside- and nucleotide- binding proteins' (3oxk; Lorimer et al ... |
| 9 | 4whx | 3u0g | http://link.springer.com/article/10.1007/s00792-016-0816-z | First structure of archaeal branched-chain amino acid aminotransferase from Thermoproteus uzoniensis specific for l-amino acids and R-amines | 2016 | KM Boyko, TN Stekhanova, AY Nikolaeva - Extremophiles, 2016 - Springer | ... Secondary structure elements were assigned by DSSP (Touw et al. ... In the previously describedstructures of holo BCATs (PDB codes: 3U0G, 1I1K, 1WRV), the interdomain loop was found tobe ... 7) as well as in complexes of other BCATs (for example: 2EIY, 1IYE, 4WHX and 1I1L ... |
| 10 | 3gka | 3r20, 4die, 3nxs, 3tk1, 4kam, 3md0 | http://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.6b00078 | Impact of Binding Site Comparisons on Medicinal Chemistry and Rational Molecular Design | 2016 | C Ehrt, T Brinkjost, O Koch - Journal of medicinal chemistry, 2016 - ACS Publications | ... of 3D structures of proteins and protein ligand complexes is one prerequisite for rational structure-based drug design that deals with the utilization of these structural data to ... Figure 1. PDB statistics on the number of released PDB entries (blue bars) and the number of new ... |