We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 5V0U | 2017 | 0 |
| 7K68 | 2021 | 0 |
| 7K69 | 2021 | 0 |
| 7K72 | 2020 | 0 |
| 7K74 | 2020 | 0 |
| 6MQH | 2018 | 0 |
| 5V0R | 2017 | 0 |
| 5UZH | 2017 | 0 |
| 7KF3 | 2020 | 0 |
| 7KI8 | 2021 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 6bfu | - | https://academic.oup.com/ve/article-abstract/6/1/veaa003/5734706 | Unraveling virus relationships by structure-based phylogenetic classification | 2020 | WM Ng, AJ Stelfox, TA Bowden- Virus Evolution, 2020 - academic.oup.com | Unraveling virus relationships by structure -based phylogenetic classification. Weng M Ng. Division of Structural Biology, Wellcome Centre for Human Genetics, University of Oxford. ... human coronavirus NL63 (3KBH); human coronavirus 229E (6ATK); porcine deltacoronavirus, PDCoV (6BFU). All chains not comprising S1-CTD (e.g. receptor and antibody fragments) were removed prior to structural alignment |
| 2 | 6c49 | - | https://link.springer.com/article/10.1007/s12010-020-03400-z | In silico study of the structure and ligand interactions of alcohol dehydrogenase from cyanobacterium Synechocystis Sp. PCC 6803 as a key enzyme for biofuel | 2020 | O Haghighi, M Moradi- Applied Biochemistry and Biotechnology, 2020 - Springer | with amino acids in Zn ion binding sites along with a slight deviation between Cys 110 in the template and Cys 106 in the homology model in the location of structural Zn PCC 6803 homology model (Cyan) superimposed onto the template crystal structure ( PDB ID: 6C49 ) (Tan |
| 3 | 6c6b | - | https://www.sciencedirect.com/science/article/pii/S0141813020344470 | Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina | 2020 | FOS Ribeiro, GS de Arajo, MGA Mendes- International Journal of, 2020 - Elsevier | Volume 165, Part A, 15 December 2020, Pages 279-290. International Journal of Biological Macromolecules. Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina The 3D structures of all possible C. neoformans and M. canis targets were obtained from the Protein Data Bank (PDB) (Protein Data Bank, 2019) with the codes 2W3N (Carbonic anhydrase 2), 3Q73 (Farnesyl transferase), 5I33 (Adenylosuccinate synthetase), 5 U29 (Acetyl-coenzyme |
| 4 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 5 | 5uxx | - | https://www.nature.com/articles/s41579-020-00450-2 | Diverse and unified mechanisms of transcription initiation in bacteria | 2020 | J Chen, H Boyaci, EA Campbell- Nature Reviews Microbiology, 2020 - nature.com | Transcription of DNA is a fundamental process in all cellular organisms. The enzyme responsible for transcription, RNA polymerase, is conserved in general architecture and catalytic function across the three domains of life. ... Fig 5 Mycobacterium tuberculosis σK–RskA (PDB ID 4NQW; panel Ae) 85, Bartonella quintana σE–NepR (PDB ID 5UXX: panel Af), |
| 6 | 6cfp | - | https://www.tandfonline.com/doi/abs/10.1080/07391102.2020.1806112 | New anti-viral drugs for the treatment of COVID-19 instead of favipiravir | 2020 | A Akta, B Tzn, R Aslan, K Sayin- Biomolecular Structure, 2020 - Taylor & Francis | According to Table 2, the 6CFP protein is not inhibited by any ligands RNA polymerase proteins with PDB IDs of 6NUR and 6NUS were reported in late 2019 and early In this calculation, the ligand and protein are flexible and solvent molecules surround the entire structure |
| 7 | 6d8w | - | https://www.sciencedirect.com/science/article/pii/S1201971219304175 | Molecular insights into evolution, mutations and receptor-binding specificity of influenza A and B viruses from outpatients and hospitalized patients in | 2020 | FX Ivan, X Zhou, SH Lau, S Rashid, JSM Teo- International Journal of, 2020 - Elsevier | Structural analyses of receptor-binding specificity Then, sialotrisaccharide 3'SLN and 6'SLN isolated from co-crystallized HA-ligand structures in Protein Data Bank ( PDB ) were respectively used as the avian and human receptor analogs to assess receptor-binding |
| 8 | 6n41 | - | https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0234869 | Whole-genome sequencing reveals origin and evolution of influenza A (H1N1) pdm09 viruses in Lincang, China, from 2014 to 2018 | 2020 | XN Zhao, HJ Zhang, D Li, JN Zhou, YY Chen, YH Sun- PloS one, 2020 - journals.plos.org | We searched and obtained the model template ( PDB ID: 6n41 .1.A) of HA protein of A/California/07/2009. We conducted a structure prediction of the trimeric HA protein by SWISS-MODEL, then the changes at the epitopes and RBSs were visualized in PyMol |
| 9 | 6nb6 | - | https://www.nature.com/articles/s41467-020-17371-6 | Cryo-EM analysis of the post-fusion structure of the SARS-CoV spike glycoprotein | 2020 | X Fan, D Cao, L Kong, X Zhang- Nature communications, 2020 - nature.com | However, structural information of the post-fusion S2 from these highly pathogenic human-infecting The structures of pre- and post-fusion SARS-CoV S glycoprotein dramatically differ This structure suggests potential targets for the development of vaccines and therapies against |
| 10 | 6nb6 | - | https://www.mdpi.com/2218-273X/10/9/1346 | Recognition of Potential COVID-19 Drug Treatments through the Study of Existing ProteinDrug and ProteinProtein Structures: An Analysis of Kinetically Active | 2020 | O Perii- Biomolecules, 2020 - mdpi.com | their binding free energies to the COVID-19 structural and non- structural protein sites The structure alignment, hydrophobicity calculation, visualization and analyses were performed with the programs Chimera each protein chain that forms a protein complex (given as a PDB file |