We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 3PZY | 2011 | 0 |
| 7SSQ | 2023 | 0 |
| 3P2Y | 2010 | 0 |
| 7SL5 | 2022 | 0 |
| 3OA3 | 2010 | 0 |
| 3O0K | 2010 | 0 |
| 5SCN | 2022 | 0 |
| 2MZY | 2015 | 0 |
| 3N7T | 2010 | 0 |
| 3LUZ | 2010 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 3k9w | - | https://www.sciencedirect.com/science/article/pii/S1570963919300469 | Structural and binding studies of phosphopantetheine adenylyl transferase from Acinetobacter baumannii | 2019 | A Gupta, PK Singh, N Iqbal, P Sharma- et Biophysica Acta (BBA, 2019 - Elsevier | PDB ID: 3ND5; 12), HpPPAT ( PDB ID: 3NV7; 13), BpPPAT ( PDB ID: 3K9W ; 14), CbPPAT ( PDB ID: 4F3R; unpublished), PaPPAT ( PDB ID: 3X1J; 15) and MaPPAT ( PDB ID: 5O06 As indicated by the structure of AbPPAT with CoA ( PDB ID: 5YH7), the ligand binding cleft |
| 2 | 4whx | 3u0g | https://www.sciencedirect.com/science/article/pii/S1570963919300494 | Functional characterization of PLP fold type IV transaminase with a mixed type of activity from Haliangium ochraceum | 2019 | YS Zeifman, KM Boyko, AY Nikolaeva- et Biophysica Acta (BBA, 2019 - Elsevier | These results complement our knowledge of the catalytic diversity of transaminases and indicate the need for further research to understand the structural basis of substrate specificity in these enzymes. Abbreviations PDB entry code, 6H65. 2.8. Structure solution and refinement |
| 3 | 3dmp | 3qbp, 3e5b, 3hm0 | https://www.sciencedirect.com/science/article/pii/S1570963920301515 | Tetramer protein complex interface residue pairs prediction with LSTM combined with graph representations | 2020 | D Sun, X Gong- Biochimica et Biophysica Acta (BBA)-Proteins and, 2020 - Elsevier | The structure diagram of LSTM neural network is shown in Fig. 3. (See Fig. 1, Fig Table 1. Dataset. DataSet, PDB ID 2H8N, 2JBR, 2NQO, 2Y32, 3DFQ, 3ESI, 3G7K, 3HM0, 3OHP, 3RD4, 3 V15, 1IZ1, 1JL2. 1KAM, 1NSW, 2GJD, 2R90, 2ZYZ, 3CDK, 3CO2, 3DMP , 3F6Z, 1BV4, 1YIF |
| 4 | 5ts2 | 3pxu | https://www.sciencedirect.com/science/article/pii/S1570963920302132 | Phosphopantetheine Adenylyltransferase: A promising drug target to combat antibiotic resistance | 2020 | A Gupta, P Sharma, TP Singh, S Sharma- Biochimica et Biophysica Acta, 2020 - Elsevier | Although, the DPCK domain of the human fusion protein shows high sequence and structural homology to bacterial DPCK The PDB IDs of the structure , percentage sequence identities and rms deviations for the C atoms are also indicated ... The structures of complexes of PPAT with dPCoA from several bacterial species have been determined so far and include EcPPAT (PDB ID: 1B6T), MtPPAT (PDB ID: 3RBA), BpPPAT (PDB ID: 3PXU), MaPPAT (PDB ID: 5O08), PaPPAT (PDB ID: 5TS2) and AbPPAT (PDB ID: 5ZZC |
| 5 | 3cxk | - | https://www.sciencedirect.com/science/article/pii/S1570963920302223 | Functional characterization of methionine sulfoxide reductases from Leptospira interrogans | 2020 | N Sasoni, MD Hartman, SA Guerrero- et Biophysica Acta (BBA, 2020 - Elsevier | The Met oxidation could change the structure and function of many proteins, not only of those redox-related but also of others involved in different metabolic pathways. Until now, there is no information about the presence or function of Msrs enzymes in Leptospira interrogans |
| 6 | 5koi | - | https://www.sciencedirect.com/science/article/pii/S1875536421600444 | Bufotenine and its derivatives: synthesis, analgesic effects identification and computational target prediction | 2021 | Z Chao, C Min, SUN Shan-Liang, W Jiao-Jiao- Chinese Journal of, 2021 - Elsevier | Class Target PDBa Glideb MMGBSA Class Target PDB Glide MMGBSA Class Target PDB Glide MMGBSA mGLuR5 4OO9 0.52 37.15 GLP1 3IOL 4.50 23.75 NaV1.7 5KOI 2.85 25.53 silver chlor- ide is added for substitution to obtain a stable structure of compound 6 with |
| 7 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 8 | 3oa1 | - | https://www.sciencedirect.com/science/article/pii/S1879625718301743 | Status of antiviral therapeutics against rabies virus and related emerging lyssaviruses | 2019 | V Du Pont, RK Plemper, MJ Schnell- Current opinion in virology, 2019 - Elsevier | RABV drug profiles, past efforts to address the problem and inhibitor candidates identified, and examine how the rapidly expanding structural insight into RABV protein organization has illuminated novel druggable target candidates ... The solved crystal structure for the N0 binding domain is depicted in teal (PDB 3OA1). The solved crystal structure for the dimerization domain is depicted in green and pink with both top and side views... |
| 9 | 6bfu | - | https://www.sciencedirect.com/science/article/pii/S1879625719300392 | Glycosylation of viral surface proteins probed by mass spectrometry | 2019 | AA Hargett, MB Renfrow- Current opinion in virology, 2019 - Elsevier | spike GP has 26 NGS with 15 in subunit 1 and 11 in subunit 2 ( PDB : 6BFU ) [89]. (e) Influenza virus hemagglutinin is a homotrimer with 11 NGS ( PDB : 4FNK) [92] can be coupled with other biological data to better understand the role of glycosylation in the structure and function |
| 10 | 6ws6 | - | https://www.sciencedirect.com/science/article/pii/S1931312820303620 | Neutralizing antibody and soluble ACE2 inhibition of a replication-competent VSV-SARS-CoV-2 and a clinical isolate of SARS-CoV-2 | 2020 | JB Case, PW Rothlauf, RE Chen, Z Liu, H Zhao- Cell host &, 2020 - Elsevier | Using an infectious molecular clone of vesicular stomatitis virus (VSV) expressing eGFP as a marker of infection, we replaced the glycoprotein gene (G) with the spike protein of SARS-CoV-2 (VSV-eGFP-SARS-CoV-2) and developed a high-throughput-imaging-based neutralization assay at biosafety level 2 ... VIR antibody set Pinto et al., 2020 S309 PDB: 6WS6 |