We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 3LR3 | 2010 | 0 |
| 5SDB | 2022 | 0 |
| 5SDA | 2022 | 0 |
| 5SD9 | 2022 | 0 |
| 5SD8 | 2022 | 0 |
| 2LHJ | 2011 | 0 |
| 5SD7 | 2022 | 0 |
| 5SD6 | 2022 | 0 |
| 5SD5 | 2022 | 0 |
| 5SD4 | 2022 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 6nb7 | - | https://www.nature.com/articles/s41598-020-73820-8 | Hot spot profiles of SARS-CoV-2 and human ACE2 receptor protein protein interaction obtained by density functional tight binding fragment molecular orbital | 2020 | H Lim, A Baek, J Kim, MS Kim, J Liu, KY Nam- Scientific reports, 2020 - nature.com | the hot spot region, we also performed the same calculation with RBD-SARS-CoV-1/antibody complexes (five experimental structural data All experimental structures calculated in this work are summarized in Table 1. All missing side chains were filled using Prime implemented |
| 2 | 6c87 | 6byq, 6nab, 6dbb | https://search.proquest.com/openview/cd4a41694b18b16f6cb97e7640174525/1?pq-origs... | Exploring Unconventional Approaches to Molecular Replacement in X-ray Crystallography with SIMBAD | 2020 | AJ Simpkin - 2020 - search.proquest.com | to finding search models for MR is to use the sequence of the target structure to identify a approach is based on the assumption that sequence similarity is a useful guide to structural similarity final step is a brute-force search of a non-redundant derivative of the PDB provided by |
| 3 | 6c49 | - | https://link.springer.com/article/10.1007/s12010-020-03400-z | In silico study of the structure and ligand interactions of alcohol dehydrogenase from cyanobacterium Synechocystis Sp. PCC 6803 as a key enzyme for biofuel | 2020 | O Haghighi, M Moradi- Applied Biochemistry and Biotechnology, 2020 - Springer | with amino acids in Zn ion binding sites along with a slight deviation between Cys 110 in the template and Cys 106 in the homology model in the location of structural Zn PCC 6803 homology model (Cyan) superimposed onto the template crystal structure ( PDB ID: 6C49 ) (Tan |
| 4 | 6c6b | - | https://www.sciencedirect.com/science/article/pii/S0141813020344470 | Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina | 2020 | FOS Ribeiro, GS de Arajo, MGA Mendes- International Journal of, 2020 - Elsevier | Volume 165, Part A, 15 December 2020, Pages 279-290. International Journal of Biological Macromolecules. Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina The 3D structures of all possible C. neoformans and M. canis targets were obtained from the Protein Data Bank (PDB) (Protein Data Bank, 2019) with the codes 2W3N (Carbonic anhydrase 2), 3Q73 (Farnesyl transferase), 5I33 (Adenylosuccinate synthetase), 5 U29 (Acetyl-coenzyme |
| 5 | 5j3b | - | https://edoc.ub.uni-muenchen.de/26990/ | The translation elongation factor P in actinobacteria | 2020 | B Pinheiro Damasceno Florentino - 2020 - edoc.ub.uni-muenchen.de | NC Nascent peptide-chain ORF Open reading frame PCR Polymerase chain reaction PDB Protein data EF- P facilitates translation of XPPX motifs is based in many structural studies... Structural superposition and ribbon representations of available EF-P structures. C. glutamicum (PDB code 6S8Z, orange, this work), Acinetobacter baumannii (PDB code: 5J3B, blue), E. coli ( |
| 6 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 7 | 6cfp | - | https://www.tandfonline.com/doi/abs/10.1080/07391102.2020.1806112 | New anti-viral drugs for the treatment of COVID-19 instead of favipiravir | 2020 | A Akta, B Tzn, R Aslan, K Sayin- Biomolecular Structure, 2020 - Taylor & Francis | According to Table 2, the 6CFP protein is not inhibited by any ligands RNA polymerase proteins with PDB IDs of 6NUR and 6NUS were reported in late 2019 and early In this calculation, the ligand and protein are flexible and solvent molecules surround the entire structure |
| 8 | 3h81 | - | https://link.springer.com/content/pdf/10.1007/s12275-020-0089-1.pdf | Structural and sequence comparisons of bacterial enoyl-CoA isomerase and enoyl-CoA hydratase | 2020 | J Hwang, CS Jeong, CW Lee, SC Shin, HW Kim- Journal of, 2020 - Springer | (D) The electrostatic surface potential of the trimeric HyECH structure also shows that the periphery of the putative ligand-binding site has a positive charge MtECH, ECH from M. tuberculosis ( PDB code 3H81 ). Page 7. Crystal structures of BoECI and HyECH 7 |
| 9 | 3qi6 | 6cja | https://www.nature.com/articles/s41598-020-71756-7 | Catalytic specificity of the Lactobacillus plantarum cystathionine -lyase presumed by the crystallographic analysis | 2020 | Y Matoba, M Noda, T Yoshida, K Oda, Y Ezumi- Scientific Reports, 2020 - nature.com | The reverse transsulfuration pathway, which is composed of cystathionine -synthase (CBS) and cystathionine -lyase (CGL), plays a role to synthesize l-cysteine using l-serine and the sulfur atom in l-methionine. A plant-derived lactic acid bacterium Lactobacillus plantarum SN35N |
| 10 | 3r9r | - | https://www.freepatentsonline.com/y2020/0297660.html | APPLICATIONS OF SPERMINE AND DERIVATIVES THEREOF | 2020 | W Pan, W Zhu- US Patent App. 16/889,500, 2020 - freepatentsonline.com | pneumonia (4FGR, 4FE2), Mycobacterium abscessus ATCC 19977/DSM 44196 ( 3R9R ), Thermotoga maritime On the basis of the above results, the crystal structure conformations in synthetases of Saccharormyces cerevisiae ( PDB : 2CNQ) and Escherichia coli ( PDB : 2GQS) are |