SSGCID
Seattle Structural Genomics Center for Infectious Disease

Cited Structures: list of articles citing SSGCID structures

We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.

This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.

Cited structures

Manually reviewed citations

# PDB Additional SSGCID structures cited Link Title Year Citation Highlighted abstract
1 4eqy - http://www.ingentaconnect.com/content/ben/cpd/2013/00000019/00000036/art00013 Lipid A Biosynthesis of Multidrug-Resistant Pathogens-A Novel Drug Target 2013 CR Lee, J Hun Lee, B Chul Jeong? - Current pharmaceutical design, 2013 - ingentaconnect.com ... (B) Structure of Burkholderia thai- landensis LpxC homotrimer (PDB ID, 4EQY). This structure shows that the catalytic residue (red) and the substrate-binding residues (blue) clustered around the hydrophobic cleft located between adjacent monomers. ...
2 3obk - http://www.ingentaconnect.com/content/ben/ctmc/2013/00000013/00000001/art00006 Impact of quaternary structure dynamics on allosteric drug discovery 2013 EK Jaffe - Current topics in medicinal chemistry, 2013 - ingentaconnect.com ... Toxoplasma gondii PBGS (PDB id 3OBK, shown left) contains a 13 amino acid C-terminal exten- sion that forms a domain swapped beta sheet (orange/yellow), which locks the dimer into the pro-octamer conformation. Pseudomonas ...
3 4gri 4g6z http://www.ingentaconnect.com/content/ben/ctmc/2016/00000016/00000006/art00006 Interplay between Catalysts and Substrates for Activity of Class Ib Aminoacyl-tRNA Synthetases and Implications for Pharmacology 2016 P Stephen, SX Lin, R Gieg - Current topics in medicinal , 2016 - ingentaconnect.com ... Eukarya) and limited records for ArgRS (13 PDB entries) and LysRS-1 (1 PDB entry ... with that ofEcoGlnRS and dem- onstrated the presence of GluRS-specific secondary-structure insertions ...aaRS:small ligands Eco (4OBY) Bbu(4GRI) Bth(4G6Z) Tel (2CFO) Tma (3AFH) Tth (1J09 ...
4 3uw3 - http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin 2016 P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ...
5 3gaf - http://www.ingentaconnect.com/content/ben/ppl/2014/00000021/00000009/art00004 Carboxyl-Terminal and Arg38 are Essential for Activity of the 7α-Hydroxysteroid Dehydrogenase from Clostridium absonum 2014 D Lou, B Wang, J Tan, L Zhu - Protein and peptide letters, 2014 - ingentaconnect.com ... E. coli (Ec 7α-HSDH, PDB code: 1FMC) [21] and Brucella melitensis (PDB code: 3GAF) havebeen ... and arginine at position 37 of the human estro- genic 17β-HSDH (PDB code: 1QYV ... 38 isof vital importance, and the residue- replacement disrupts the normal structure for cofactor ...
6 4lfy - http://www.ingentaconnect.com/contentone/ben/cchts/2017/00000020/00000006/art000... Targeting Pyrimidine Pathway of Plasmodium knowlesi: New Strategies Towards Identification of Novel Antimalarial Chemotherapeutic Agents 2017 M Rashmi, MK Yadav, D Swati- Combinatorial chemistry & high, 2017 - ingentaconnect.com The structural quality factors and overall Z-scores of simulated PkDHOase structure were found within the valid limits, and thus may be used for drug design purposes Organism Query Coverage (%) Identity (%) PDB ID Burkholderia cenocepacia J2315 96 32 4LFY
7 4iuj 4p9a, 3r2v, 3khw http://www.ingentaconnect.com/contentone/ben/cdth/2017/00000012/00000002/art0000... Current Drug Design Strategies for Fighting Against Swine Influenza 2017 M Alam, S Nandi- Current Drug Therapy, 2017 - ingentaconnect.com ... In-silico docking studies are at the fore front of structure based screening and designing of emerg- ing anti-swine ... PDB IDs of Crystal Structures ... 5D8U, 5D9J, 5DEB, 5DES, 5I13, 5CXR, 5FDD, 5FDG, 4ZQQ, 4ZHZ, 4ZI0, 4YYL, 4W9S, 4P9A, 4MK1, 4MK2, 4MK5, 4IUJ , 4F7M, 4AWK ...
8 3qh4 - http://www.intechopen.com/books/tuberculosis-current-issues-in-diagnosis-and-man... Lipid Inclusions in Mycobacterial Infections 2013 M Stehr, AA Elamin, M Singh - 2013 - intechopen.com ... Furthermore the three-dimensional structures of the esterases Rv0045c (PDB 3P2M) [78], Rv1847 (PDB 3S4K), and LipW (3QH4) from M. tuberculosis have been determined, but unfortunately it is not known whether these enzymes are involved in TAG hydrolysis. 3.5. ...
9 3uf8 3vaw http://www.intelligentmodelling.org.uk/Projects/lingwei/lingwei-final.pdf A Research on the Use of Voxel Tessellations in the Representation, Investigation and Identification of Protein Surface Atoms and Binding Sites 2012 LL Wei - 2012 - intelligentmodelling.org.uk ... 110 5-13 Visualisations for identified dock site of protein 3UF8 from both RCSB PDB and thevoxel-based method, ... The increasing number of entries being deposited into the Protein DataBank (PDB) ... al, 2007) gives a comprehensive ordering of all proteins of known structure ...
10 3uam - http://www.ir.juit.ac.in:8080/jspui/bitstream/123456789/16581/1/SP13412_RADHIKA%... Computational Studies on Substrate Specificity in Lytic Polysaccharide Monooxygenases 2018 R Arora, RM Yennamalli - 2018 - ir.juit.ac.in 4ALS, 4ALT), Burkholderia pseudomallei CBM33 ( PDB ID: 3UAM ) [10], Bacillus coelicolor CBM2 ( PDB ID: 4OY7), Cellvibrio japonicas CBP33 ( PDB ID: 5FJQ). Page 17. 3 1.5 LPMO and substrate interactions Due to the binding of copper LPMO structure gets stabilized