We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 8W0J | 2024 | 0 |
| 8W0L | 2024 | 0 |
| 8W0M | 2024 | 0 |
| 8W20 | 2024 | 0 |
| 8W21 | 2024 | 0 |
| 8W22 | 2024 | 0 |
| 9ASD | 2024 | 0 |
| 9ATM | 2024 | 0 |
| 9AU2 | 2024 | 0 |
| 9AV6 | 2024 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 6c6b | - | https://www.sciencedirect.com/science/article/pii/S0141813020344470 | Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina | 2020 | FOS Ribeiro, GS de Arajo, MGA Mendes- International Journal of, 2020 - Elsevier | Volume 165, Part A, 15 December 2020, Pages 279-290. International Journal of Biological Macromolecules. Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina The 3D structures of all possible C. neoformans and M. canis targets were obtained from the Protein Data Bank (PDB) (Protein Data Bank, 2019) with the codes 2W3N (Carbonic anhydrase 2), 3Q73 (Farnesyl transferase), 5I33 (Adenylosuccinate synthetase), 5 U29 (Acetyl-coenzyme |
| 2 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 3 | 6c87 | 6byq | https://scripts.iucr.org/cgi-bin/paper?rr5159 | SIMBAD: a sequence-independent molecular-replacement pipeline | 2018 | AJ Simpkin, F Simkovic, JMH Thomas- Section D: Structural, 2018 - scripts.iucr.org | researchers involved. All cases involve the crystallization of a known contaminant. Examples involving the use of SIMBAD for novel structure solution are available elsewhere, such as PDB entries 6byq, 6c87 and 5wol. Cases illustrating |
| 4 | 6c87 | 6byq, 6nab, 6dbb | https://search.proquest.com/openview/cd4a41694b18b16f6cb97e7640174525/1?pq-origs... | Exploring Unconventional Approaches to Molecular Replacement in X-ray Crystallography with SIMBAD | 2020 | AJ Simpkin - 2020 - search.proquest.com | to finding search models for MR is to use the sequence of the target structure to identify a approach is based on the assumption that sequence similarity is a useful guide to structural similarity final step is a brute-force search of a non-redundant derivative of the PDB provided by |
| 5 | 6c9c | - | https://www.biorxiv.org/content/10.1101/863571v1.abstract | Disorder and interfaces in proteins are two sides of the same coin | 2019 | B Seoane, A Carbone- bioRxiv, 2019 - biorxiv.org | c. Analysis of cluster 6c9c A ( PDB IDs for the structures are given in SI section S2). In the external wheel, we show one unbound structure and the chain structures containing the 12 different interfaces of this cluster: DRs in orange and IRs in blue |
| 6 | 6c9e | - | https://www.nature.com/articles/s42003-024-07299-8 | The structural and functional analysis of mycobacteria cysteine desulfurase-loaded encapsulin | 2024 | Y Tang, Y Liu, M Zhang, W Lan, M Ma, C Chen- Communications, 2024 - nature.com | ( PDB 6C9E ) as the initial model. Model building and refinement was performed within Coot 0.8.9.2 and Phenix 1.14, respectively. The final refined models were validated by MolProbity |
| 7 | 6c9e | - | https://escholarship.org/uc/item/5rh0j6b2 | Molecular and shell biologyexamining the biochemistry and physiology of prokaryotic nanocompartments | 2020 | RJ Nichols - 2020 - escholarship.org | (B) Size comparison of the nanocompartments to GFP [ PDB : 1C4F], the HK97 viral capsid [ PDB : 1OHG], and the Lastly, given that there is no known structure of a DyP- packaging encapsulin, these nanocompartments may have a pore architecture that permits transit |
| 8 | 6c9e | - | https://www.biorxiv.org/content/10.1101/2020.05.24.113720v1.abstract | Discovery and characterization of a novel family of prokaryotic nanocompartments involved in sulfur metabolism | 2020 | RJ Nichols, B LaFrance, NR Phillips, LM Oltrogge- bioRxiv, 2020 - biorxiv.org | additional density for the holo-SrpI with a 243 homologous cysteine desulfurase dimer docked in ( pdb : 6c9e ) the first Family 2 encapsulin structure and is 267 the highest resolution structure for an Given the structural 271 similarity of the entire shell, it is unsurprising that the SrpI |
| 9 | 6c9e | 5vpr | https://scripts.iucr.org/cgi-bin/paper?mn5126 | Structural evidence for a latch mechanism regulating access to the active site of SufS-family cysteine desulfurases | 2020 | JA Dunkle, MR Bruno, PA Frantom- Section D: Structural Biology, 2020 - scripts.iucr.org | Q5ZXX6 6c9e , A L. pneumophila Lpg0604 Resting state Page 7 Six sequences/ structures belong to the IPR010970 SufS family by sequence homology, and inspection of these structures reveals that five possess the -hairpin structure and one, PDB entry 5vpr from |
| 10 | 6cau | - | http://www.bdjn.org/APP_PDF/BDJN006-03-04.pdf | Phase determination of the UDP-N-acetylmuramic acid: L-alanine ligase (MurC) crystal from Mycobacterium bovis | 2018 | PW Seo, JS Kim - 2018 - bdjn.org | Haemophilus influenzae ( PDB ID 1P31, 1GQQ), Acinetobacter baumannii ( PDB ID 6CAU ), Yersinia pestis ( PDB ID 4HV4 of the PHENIX suite (Adams et al., 2010) using Y. pestis MurC ( PDB ID 4HV4 Structure of Escherichia coli UDP-N-acetylmuramoyl: L-alanine ligase (MurC) |