We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 2 | 3oa1 | - | https://www.sciencedirect.com/science/article/pii/S1879625718301743 | Status of antiviral therapeutics against rabies virus and related emerging lyssaviruses | 2019 | V Du Pont, RK Plemper, MJ Schnell- Current opinion in virology, 2019 - Elsevier | RABV drug profiles, past efforts to address the problem and inhibitor candidates identified, and examine how the rapidly expanding structural insight into RABV protein organization has illuminated novel druggable target candidates ... The solved crystal structure for the N0 binding domain is depicted in teal (PDB 3OA1). The solved crystal structure for the dimerization domain is depicted in green and pink with both top and side views... |
| 3 | 6bfu | - | https://www.sciencedirect.com/science/article/pii/S1879625719300392 | Glycosylation of viral surface proteins probed by mass spectrometry | 2019 | AA Hargett, MB Renfrow- Current opinion in virology, 2019 - Elsevier | spike GP has 26 NGS with 15 in subunit 1 and 11 in subunit 2 ( PDB : 6BFU ) [89]. (e) Influenza virus hemagglutinin is a homotrimer with 11 NGS ( PDB : 4FNK) [92] can be coupled with other biological data to better understand the role of glycosylation in the structure and function |
| 4 | 6ws6 | - | https://www.sciencedirect.com/science/article/pii/S1931312820303620 | Neutralizing antibody and soluble ACE2 inhibition of a replication-competent VSV-SARS-CoV-2 and a clinical isolate of SARS-CoV-2 | 2020 | JB Case, PW Rothlauf, RE Chen, Z Liu, H Zhao- Cell host &, 2020 - Elsevier | Using an infectious molecular clone of vesicular stomatitis virus (VSV) expressing eGFP as a marker of infection, we replaced the glycoprotein gene (G) with the spike protein of SARS-CoV-2 (VSV-eGFP-SARS-CoV-2) and developed a high-throughput-imaging-based neutralization assay at biosafety level 2 ... VIR antibody set Pinto et al., 2020 S309 PDB: 6WS6 |
| 5 | 5jry | - | https://www.sciencedirect.com/science/article/pii/S2001037018301545 | Molecular Mechanisms of Bacterial Bioluminescence | 2018 | E Brodl, A Winkler, P Macheroux- Computational and Structural, 2018 - Elsevier | we also show stick models of the substrate analog (indole-3-acetaldehyde – blue) and the cofactor (NADP+ − grey) in the respective binding sites obtained from the superposition of the LuxC model with indole-3-acetaldehyde dehydrogenase from Pseudomonas syringae (PDB 5IUW) and from the structure of an aldehyde dehydrogenase from Burkholderia multivorans (PDB 5JRY), respectively. |
| 6 | 4g67 | 4f3n | https://www.sciencedirect.com/science/article/pii/S2211124718311938 | Proteobacterial Origin of Protein Arginine Methylation and Regulation of Complex I Assembly by MidA | 2018 | UFS Hameed, O Sanislav, ST Lay, SJ Annesley- Cell reports, 2018 - Elsevier | (A) Secondary structure representation of the MidA crystal structure bound to SAH (E) Superimposition of MidA (green) onto the putative protein Q6N1P6 ( PDB : 1zkd) from R. palustris (orange) and ACR COG1565 ( PDB : 4g67 ) from B. thailandensis (purple); RMSD = 1.68 |
| 7 | 5j3b | - | https://www.sciencedirect.com/science/article/pii/S2211124720303089 | Structure and Function of an Elongation Factor P Subfamily in Actinobacteria | 2020 | B Pinheiro, CM Scheidler, P Kielkowski, M Schmid- Cell Reports, 2020 - Elsevier | In order to gain insights into the structural configuration of this Actinobacteria EF-P, we X-ray crystal structure to 2.2- resolution (for data processing and structure refinement statistics its overall folding topology with the previously reported bacterial EF-P structures and consists of |
| 8 | 7k43 | - | https://www.sciencedirect.com/science/article/pii/S2211124722005344 | Structures of Omicron spike complexes and implications for neutralizing antibody development | 2022 | H Guo, Y Gao, T Li, T Li, Y Lu, L Zheng, Y Liu, T Yang- Cell reports, 2022 - Elsevier | The recently reported structural model PDB entry 7T9K (Mannar et al., 2022) was used as an initial template for model building of the Omicron Spike trimer and ACE2. PDB entry 7K43 |
| 9 | 3mmt | - | https://www.sciencedirect.com/science/article/pii/S2352340916304905 | Interaction network and mass spectrometry data of Xanthomonas citri subsp. citri surface proteins from differential proteomic analysis of infectious and non | 2016 | CM Carnielli, J Artier, JCF de Oliveira- Data in brief, 2016 - Elsevier | ID, Gene symbol, ENSEMBL, SWISS-PROT, Protein structure ( PDB ), Conserved domain (CDD), Gene ontology (GO) GO:0003735 structural constituent of ribosome citri (strain 306) GN=XAC3344 PE=3 SV=1, 3mmt Fructose-bisphosphate aldolase, cd00948, FBP_aldolase_I_a |
| 10 | 5bq2 | - | https://www.sciencedirect.com/science/article/pii/S2352914818301060 | Molecular modelling and dynamic simulation of UDP-N-acetylglucosamine 1-carboxyvinyltransferase (MurA) from Mycobacterium tuberculosis using in silico | 2018 | MA Isa, RS Majumdar, S Haider- Informatics in Medicine, 2018 - Elsevier | structure of UDP-N-acetylglucosamine -1-carboxyvinyltransferase (MurA) is not available in PDB . Therefore, the 3D structure was determined through the sequence, obtained from NCBI (Accession result of a BLASTp search against PBD, six proteins (3SG1, 5BQ2 , 3ISS, 1A2N |