We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 5IDQ | 2016 | 0 |
| 6W6A | 2020 | 0 |
| 6W80 | 2020 | 0 |
| 6WBD | 2020 | 0 |
| 6WCT | 2020 | 0 |
| 5TP4 | 2017 | 0 |
| 6WFM | 2020 | 0 |
| 5THX | 2016 | 0 |
| 6WHJ | 2020 | 0 |
| 6WHP | 2020 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 4ed9 | - | http://broncoscholar.library.cpp.edu/handle/10211.3/215321 | Overexpression and Purification of the Protein BaiK for Structural Characterization by X-Ray Crystallography | 2020 | S Khuu - 2020 - broncoscholar.library.cpp.edu | Initially , BaiK was overexpressed to produce large quantity of protein for use in structural and structure being very similar to histidine while also being added at a high concentration. 11 formation of more ordered crystal structures . The effective concentration of the protein |
| 2 | 2mj3 | - | https://scholarship.rice.edu/handle/1911/108341 | Understanding and modulating electron transfer through ferredoxins | 2020 | I Campbell - 2020 - scholarship.rice.edu | 3.6. Cyanophage Fd structural characterization ..... 79 This bioinformatic study highlights understudied PECs whose structure , stability, and partner specificity should be further characterized... 1UWM, 1PDX, 1M2D, 1I7H, 3AH7, 2MJD, 2MJ3, 2Y5C, 5FFI, 3P1M, 1E0Z, 1DOI |
| 3 | 5i1f | 5j49, 5vct, 5ve7 | https://www.frontiersin.org/articles/10.3389/fmicb.2020.01596/full?report=reader | In vitro and in vivo Evaluation of in silico Predicted Pneumococcal UDPG: PP Inhibitors | 2020 | F Cools, D Triki, N Geerts, P Delputte- Frontiers in, 2020 - frontiersin.org | Currently, the crystal structure of UDPG:PP is only known for several eukaryotes and following bacteria: Helicobacter pylori ( PDB codes 3JUJ and 3JUK) (Kim et al., 2010), E. coli ( PDB code 2E3D) (Thoden and Holden ( PDB codes 5VCT, 5VE7, 5J49, 5I1F ) (Abendroth et al |
| 4 | 4ohc | - | http://bq.facmed.unam.mx/tab/wp-content/uploads/2020/06/9-Gonzalez-Segura.pdf | Orotato fosforribosiltransferasa. Pasado, presente y futuro en el estudio estructural de las protenas. | 2020 | L Gonzlez-Segura, EI Carrizosa-Carbajal - bq.facmed.unam.mx | Past, present and future in the structural study of proteins Key words: Phosphoribosyltransferase; three- dimensional structure ; conformational change; inhibition; pyrimidines synthesis str (PDBs 3M3H y 4RV4), de Burkholderia cenocepacia ( PDB 4OHC ), de Corynebacterium |
| 5 | 4ix8 | - | https://www.sciencedirect.com/science/article/pii/S0141813020341957 | Flavones reversibly inhibit Leishmania donovani tyrosine aminotransferase by binding to the catalytic pocket: An integrated in silico-in vitro approach | 2020 | S Sasidharan, P Saudagar- International Journal of Biological, 2020 - Elsevier | TAT has also been characterized in Leishmania major [26], Leishmania donovani [10], and Leishmania infantum [8]. Furthermore, the crystal structure of the TAT from L. infantum has been solved ( PDB id: 4IX8 ) [27] and the structure contained PLP in the active site cavity bound |
| 6 | 5uxx | - | https://www.nature.com/articles/s41579-020-00450-2 | Diverse and unified mechanisms of transcription initiation in bacteria | 2020 | J Chen, H Boyaci, EA Campbell- Nature Reviews Microbiology, 2020 - nature.com | Transcription of DNA is a fundamental process in all cellular organisms. The enzyme responsible for transcription, RNA polymerase, is conserved in general architecture and catalytic function across the three domains of life. ... Fig 5 Mycobacterium tuberculosis σK–RskA (PDB ID 4NQW; panel Ae) 85, Bartonella quintana σE–NepR (PDB ID 5UXX: panel Af), |
| 7 | 4q14 | - | https://researchrepository.rmit.edu.au/view/delivery/61RMIT_INST/122552998300013... | HISTIDINE PROTONATION AS A POSSIBLE MECHANISM FOR HUMAN TRANSTHYRETIN AMYLOIDOSIS: MODELLED AGAINST WALLABY | 2020 | DG D'SOUZA - 2020 - researchrepository.rmit.edu.au | 0.97 indicated a highly conserved overall structure between the solved structure of wallaby TTR and a known crystal structure of human TTR ( PDB : 3U2I). The structural homology was strong with an almost perfect overlap of their peptide backbones, secondary, tertiary and ... Table 3.3 Predicted model of human TTR compared to other structurally similar proteins 7 4Q14 Brucella 0.806 1.62 0.283 0.890 |
| 8 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 9 | 4dz4 | - | https://www.frontiersin.org/articles/10.3389/fpls.2020.00987/full?report=reader | The neighboring subunit is engaged to stabilize the substrate in the active site of plant arginases | 2020 | B Sekula- Frontiers in plant science, 2020 - frontiersin.org | It is worth noting that the structure of agmatinase from Deinococcus radiodurans ( PDB ID: 1WOG) (Ahn et al., 2004) is ID: 3LHL), agmatinase from Thermoplasma volcanium (TvAGM, PDB ID: 3PZL), and agmatinase from Burkholderia thailandensis (BtAGM, PDB ID: 4DZ4 ) |
| 10 | 4y0e | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/ange.201914896 | Pathway from Nalkylglycine to alkylisonitrile catalyzed by iron (II) and 2oxoglutarate dependent oxygenases | 2020 | WC Chang, TY Chen, J Chen, Y Tang- Angewandte, 2020 - Wiley Online Library | Table S4). Dali search suggested the structure of ScoE resembles those of other Fe/2OG-enzymes such as CarC ( PDB ID: 4oj8) and a putative dioxygenases ( PDB ID: 4y0e ), with Z-score of 20.0 and 26.7, respectively. In the |