The SSGCID has begun tracking the number of publications by the scientific community which reference Center structures. This list has been manually reviewed and contains only articles that refer to SSGCID structures, whether in the main text, figure captions or supplementary material. Publications by SSGCID authors are excluded from this list.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 6x79 | - | https://www.biorxiv.org/content/10.1101/2021.05.06.441046v1.abstract | Structure-based design of a highly stable, covalently-linked SARS-CoV-2 spike trimer with improved structural properties and immunogenicity | 2021 | E Olmedillas, CJ Mann, W Peng, YT Wang, RD Avalos- bioRxiv, 2021 - biorxiv.org | For VFLIP_D614G, a population of 213,852 particles yielded a 2.8 resolution structure (Figure S2). Importantly, the density maps confirm Further sub-classification revealed an overall architecture that is similar to other closed spikes in the Protein Data Bank ( PDB ). ... A previously published structure of the SARS-CoV-2 ectodomain with all RBDs in the down conformation (PDB ID 6X79) was used to fit the cryo-EM maps in UCSF ChimeraX |
| 2 | 3qh4 | - | https://www.biorxiv.org/content/10.1101/2021.02.23.432567v1.abstract | Structure guided engineering of a cold active esterase expands substrate range though a stabilisation mutation that allows access to a buried water chamber | 2021 | N Noby, R Johnson, J Tyzack, A Embaby, H Saeed- bioRxiv, 2021 - biorxiv.org | to fully open the HerE plug. LipW ( PDB 3QH4 ) (26) has two shorter residues in place PestE ( PDB 2YH2) (28) does not have the plug (Figure 2b). N211 is replaced by a of helical character than the WT suggesting a higher degree of structure for the mutant at this temperature |
| 3 | 4lgv | - | https://www.sciencedirect.com/science/article/pii/S0006291X21003016 | Structural basis for substrate recognition of glucose-6-phosphate dehydrogenase from Kluyveromyces lactis | 2021 | HH Vu, C Jin, JH Chang- Biochemical and Biophysical Research, 2021 - Elsevier | The overall structure of Kluyveromyces lactis G6PD (cyan), Homo sapiens G6PD ( PDB code, 2BHL; red), Trypanosoma cruzi code, 6D23; yellow), Leuconostoc mesenteroides G6PD ( PDB code, 1DPG; purple), and Mycobacterium avium G6PD ( PDB code, 4LGV ; green) |
| 4 | 6tz8 | - | https://www.currentscience.ac.in/data/forthcoming/206.pdf | Uneditedversion published onlineon 15/7/2021 | 2021 | G Biswas, R Banerjee - currentscience.ac.in | exclusively with P2, while P1 mediates molecular recognition and binding, as evident from the crystal structures of (truncated) SurA-peptide complexes46 The crystal structure of CaEss1 showed structural similarity to the human PIN1 protein except for the |
| 5 | 6ns0 | - | https://www.sciencedirect.com/science/article/pii/S0039128X21001240 | Synthesis of erythrodiol C-ring derivatives and their activity against Chlamydia trachomatis | 2021 | O Kazakova, L Rubanik, A Lobov, N Poleshchuk- Steroids, 2021 - Elsevier | activity, for example, the presence of ,-unsaturated system in the structure of CDDO (2-cyano-3,12-diooxoolean-1,9-dien-28-oic acid) has a sufficient influence on anti-inflammatory, anti-diabetic nephropathy, and cytotoxic activities [14], [15] Figure 1. Structures of oleanolic |
| 6 | 2lwk | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/advs.202004379 | Light-Driven Cascade Mitochondria-to-Nucleus Photosensitization in Cancer Cell Ablation | 2021 | KN Wang, LY Liu, G Qi, XJ Chao, W Ma, Z Yu- Advanced, 2021 - Wiley Online Library | Herein, a light-driven, mitochondria-to-nucleus cascade dual organelle cancer cell ablation strategy is reported. structure of BT-Ir and DNA structure (5-CAATCGGATCGAATTCGATCCGATTG- 3, PDB code: 5ju4) and RNA structure (5- GAGUAGAAACAAGGCUUCGG CCUGCUUUUGCU-3, PDB code: 2lwk ) using AutoDock 4.2 |
| 7 | 5vbf | - | https://www.biorxiv.org/content/10.1101/2021.07.15.452591.abstract | The tetrameric assembly of 2-aminomuconic acid dehydrogenase is a functional requirement of cofactor NAD+ binding | 2021 | Q Shi, Y Chen, X Li, H Dong, C Chen, Z Zhong, C Yang- bioRxiv, 2021 - biorxiv.org | 144 The overall structure of AmnC protomers shares the general architecture of the ALDH 145 family (SSADH) ( PDB code:2W8P)(23-26). Pairwise superposition of the six protomers yielded 164 In this study, we elucidated the structure of AmnC and how it 260 |
| 8 | 5udf | - | https://www.nature.com/articles/s41594-021-00573-x | Structural basis for bacterial lipoprotein relocation by the transporter LolCDE | 2021 | X Tang, S Chang, K Zhang, Q Luo, Z Zhang- Nature Structural &, 2021 - nature.com | Advertisement. Advertisement. Nature Structural & Molecular Biology. View all journals; Search; My Account Login. Explore content; Journal information; Publish with us Structural basis for bacterial lipoprotein relocation by the transporter LolCDE |
| 9 | 6ws6 | - | https://sciendo.com/pdf/10.2478/rrlm-2021-0022 | Insights into Innate Immune Response Against SARS-CoV-2 Infection | 2021 | A Huanu, AM Georgescu, AV Andrejkovits- Revista Romn de, 2021 - sciendo.com | The NET structure made by activated neutrophils and mediated by reactive oxygen species bacterial lipopolysaccharides (LPS), flagella, cilia, bacterial unmethylated DNA, or viral structures like dsARN or In addition, sev- eral structural and non- structural SARS-CoV-2 proteins |
| 10 | 5vp5 | - | https://aca.scitation.org/doi/full/10.1063/4.0000089 | Developing a macromolecular crystallography driven CURE | 2021 | KJ McLaughlin - 2021 - aca.scitation.org | While these protein x-ray crystallography structures are key to allowing students to CURE that could expose and excite a next generation of potential structural scientists 3 3. KJ McLaughlin, Understanding structure : A computer-based macromolecular biochemistry lab activity, J |
| 11 | 6x79 | - | https://www.sciencedirect.com/science/article/pii/S0141813021015956 | Chitosan derivatives: A suggestive evaluation for novel inhibitor discovery against wild type and variants of SARS-CoV-2 virus | 2021 | C Modak, A Jha, N Sharma, A Kumar- International Journal of Biological, 2021 - Elsevier | of efficacious treatment strategies to robustly tackle this pandemic by targeting various pathways and mechanisms of infection by either creating new drug molecules or repurpose already existing drug molecules for impacting virus infection cycle or structural proteins [2] ... For heparan sulfate proteoglycan/heparin-binding site as target site, the homotrimerectodomain in prefusion state of S-glycoprotein PDB ID: 6X79 with a low resolution of 2.90 Å was considered |
| 12 | 6x79 | - | https://www.biorxiv.org/content/10.1101/2021.02.25.432861v3.abstract | Antiviral Resistance against Viral Mutation: Praxis and Policy for SARS CoV-2 | 2021 | RC Penner- BioRxiv, 2021 - biorxiv.org | E of rotations of BHBs in HQ60; Table 1, Protein Data Bank structure files upon The methods of this paper are im- plented online from an uploaded PDB file at et al., Hydrogen bond rotations as a uniform structural tool for analyzing protein architecture , Nature Communications, 5 |
| 13 | 6nbo | - | https://www.sciencedirect.com/science/article/pii/S0022286021007304 | Synthesis and investigation of heterocyclic systems as pharmacological agents with conformational study and surface activity | 2021 | R El-Sayed, I Althagafi, M Morad, SM El-Bahy- of Molecular Structure, 2021 - Elsevier | The structure of recent products was illustrated by IR and 1 HNMR spectra a) and virtual simulation was accomplished upon harmful pathogen-protein as co-crystalline PDB file 3coi, 5ahi, 6nbo and 6ocr co-crystal proteins obtained from Protein Database (RCSB PDB : Homepage |
| 14 | 3ijp | - | https://www.sciencedirect.com/science/article/pii/S0304416520302610 | Comparative structural and mechanistic studies of 4-hydroxy-tetrahydrodipicolinate reductases from Mycobacterium tuberculosis and Vibrio vulnificus | 2021 | S Pote, S Kachhap, NJ Mank, L Daneshian- et Biophysica Acta (BBA, 2021 - Elsevier | This paper focuses on structural and mechanistic studies of DapB The structure for DapB has been determined from various bacterial species including Escherichia coli [14], Bartonella henselae [15 Fig. 2. (A) Tetrameric assembly of DapB from V. vulnificus ( PDB ID: 5TEN) |
| 15 | 5vp5 | 3enn | https://www.nature.com/articles/s41598-021-86400-1 | Insights into Acinetobacter baumannii fatty acid synthesis 3-oxoacyl-ACP reductases | 2021 | EM Cross, FG Adams, JK Waters, D Arago- Scientific reports, 2021 - nature.com | Treatments for 'superbug' infections are the focus for innovative research, as drug resistance threatens human health and medical practices globally. In particular, Acinetobacter baumannii (Ab) infections are repeatedly reported as difficult to treat due to increasing antibiotic resistance |
| 16 | 4yet | 3js4 | http://www.doiserbia.nb.rs/Article.aspx?id=0352-51392100042S | Amide- interactions in active centers of superoxide dismutase | 2021 | S Stojanovi, ZZ Petrovi- Journal of the Serbian, 2021 - doiserbia.nb.rs | A, 3js4:A, 3lio:A, 3lsu:A, 3mds:A, 3pu7:A, 3tqj:A, 4br6:A, 4c7u:A, 4f2n:A, 4ffk:A, 4yet :A, 5a9g 7. Example of the structure preferred amide interactions of FeSOD from the Thermosynechococcus elongatus ( PDB code 1my6): (a) parallel-displaced and (b) T-shaped structure |
| 17 | 6wps | 6vxx | https://academic.oup.com/nar/article-abstract/49/D1/D282/5901966 | CoV3D: a database of high resolution coronavirus protein structures | 2021 | R Gowthaman, JD Guest, R Yin- Nucleic acids, 2021 - academic.oup.com | (A) Visualization of the superposed spike RBD complexes with antibody S309 ( PDB code 6WPS ) ( 20 ) and (B) A trimeric spike structure in RBD-closed conformation ( 5 ) ( PDB code 6VXX Park YJ, Tortorici MA, Wall A., McGuire AT and Veesler D. (2020) Structure , Function, and |
| 18 | 6cw5 | - | https://ubipayroll.com/earthline/index.php/ejcs/article/view/282 | In silico Structural Modelling of Ribokinase from Salmonella Typhi | 2021 | H Abubakar, Y Ndatsu, AD Musa, C Ogbiko- Earthline Journal of, 2021 - ubipayroll.com | done to check the stereochemical features of the predicted 3-dimensional structure of the BLASTp showed low identity of 40% (Table 1) with other proteins deposited in PDB and conserved domain (Figure 1). Multiple sequence alignment between the query, 6CW5 , 2FV7, 1VM7 |
| 19 | 4wbs | - | https://journals.asm.org/doi/abs/10.1128/JB.00082-21 | Structural modeling of the Treponema pallidum OMPeome: a roadmap for deconvolution of syphilis pathogenesis and development of a syphilis vaccine | 2021 | KL Hawley, JM Montezuma-Rusca- Journal of, 2021 - Am Soc Microbiol | TP0786 Phyre2 LptB; Burkholderia phymatum; 4WBS 50 conserved in T. pallidum BamA, we performed structure -based sequence alignment of the 170 TP0326 3D model with the crystal structures of E. coli BamA ( PDB ID: 5D0Q, 5D0O) (60). The 171 |
| 20 | 6xdh | - | https://www.biorxiv.org/content/10.1101/2021.06.02.446845v1.abstract | 3D-Scaffold: Deep Learning Framework to Generate 3D Coordinates of Drug-like Molecules with Desired Scaffolds. | 2021 | RP Joshi, N Gebauer, N Kumar, M Bontha- bioRxiv, 2021 - biorxiv.org | generates 3D coordinates of the molecules with a given core structure ; (II) It works equally 3 reasonable molecules even with small training datasets due to the robust architecture of the (Mpro) and a SARS-CoV-2 non- structural protein endoribonuclease (NSP15). ... As a test case example, we generated non-covalent inhibitors for the SAR-CoV-2 non-structural protein endoribonuclease (NSP15) target (PDB ID: 6XDH) by optimizing Exebryl-1 based compounds |
| 21 | 6nbo | - | https://www.sciencedirect.com/science/article/pii/S0269749120364927 | Purification, characterization, and catalytic mechanism of N-Isopropylammelide isopropylaminohydrolase (AtzC) involved in the degradation of s-triazine | 2021 | N Zhou, J Wang, W Wang, X Wu- Environmental Pollution, 2021 - Elsevier | The structural architecture of AtzC resembled that of cytosine deaminase in class III Purification and structural characterization of AtzE produced by the model bacterium Pseudomonas sp and substrate specificity of AtzC were studied, and the function, structure , and evolutionary |
| 22 | 5vpq | - | https://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.15854 | Conserved residues Glu37 and Trp229 play an essential role in protein folding of lactamase | 2021 | A Chikunova, MP Manley, M Ud Din Ahmad- The FEBS, 2021 - Wiley Online Library | (2013). Cation- Interactions in -Lactamases: The Role in Structural Stability, Cell Biochem. Biophys. 66, 147155 [49] RP Joosten, F. Long, GN Murshudov & A. Perrakis. (2014). The PDB -REDO server for macromolecular structure model optimization, IUCrJ. 1, 213220 ... Pro226-Trp229-Pro251-Pro252-(Phe287) chain: β-lactamase from Burkholderia phymatum—gold (5VPQ), ... |
| 23 | 4kzk | - | https://link.springer.com/article/10.1007/s10930-021-09970-z | Structural Flexibility of Peripheral Loops and Extended C-terminal Domain of Short Length Substrate Binding Protein from Rhodothermus marinus | 2021 | JE Bae, IJ Kim, Y Xu, KH Nam- The protein journal, 2021 - Springer | of RmSBP, we performed comparative analysis and substrate docking studies using a previously reported crystal structure of SBP ( PDB code 5Z6V) as the initial model structure Among them, 9 models ( PDB codes: 3LFT, 2QH8, 5ER3, 4RS3, 4KZK , 5BRA, 3KSM, 2DRI |
| 24 | 4mei | 4o3v, 4jf8, 4lso, 4nhf, 4kz1 | https://www.frontiersin.org/articles/10.3389/fmolb.2021.642606/full | Structural and Biochemical Analysis of OrfG: The VirB8-like Component of the Conjugative Type IV Secretion System of ICESt3 From Streptococcus | 2021 | J Cappele, A Mohamad Ali- Frontiers in molecular, 2021 - frontiersin.org | The first step of structure comparison was conducted with both DALI (Holm and Sander, 1995) and and Henrick, 2004) to fetch a complete list of VirB8 structures (26 PDB entries 16 structures was conserved (2cc3, 3ub1, 3wz3, 3wz4, 4akz, 4ec6, 4jf8, 4kz1, 4lso, 4mei , 4nhf, 4o3v |
| 25 | 4ziy | - | https://www.tandfonline.com/doi/abs/10.1080/07391102.2021.1908913 | Identification of novel multitarget antitubercular inhibitors against mycobacterial peptidoglycan biosynthetic Mur enzymes by structure-based virtual screening | 2021 | M Kumari, N Subbarao- Journal of Biomolecular Structure and, 2021 - Taylor & Francis | extracted eight protein templates: 1GG4, 2AM1, 3ZM5, 4CVK, 4QDI, 4QDI, 4QF5 and 4ZIY , which identity best model with the low RMS value of superposition using Swiss- pdb viewer (Guex The modeled 3D structure of Mur enzymes showed close similarity to 3D crystal protein |
| 26 | 6x79 | - | https://www.biorxiv.org/content/10.1101/2021.02.17.431625v1.abstract | A rigorous framework for detecting SARS-CoV-2 spike protein mutational ensemble from genomic and structural features | 2021 | S Fatihi, S Rathore, A Pathak, D Gahlot, M Mukerji- bioRxiv, 2021 - biorxiv.org | Cryo-EM structures of the D614G spike structure have revealed that the mutant D614 is stable with RBD in an up mational states of the spike were analysed (see Methods for PDB ids) spike conformers showed large structural changes, with an average deviation of 2.77 0.42 ... 18 cryo-EM structures for closed spike conformation (PDB ID: 6ZGE, 6VXX, 6X2C, 6X6P, 6X29, 6X79, 6XF5, 6XLU, 6XM5, 6ZB4, 6ZB5, 6ZGI, 6ZP0, 7CAB, 7DDD, 7DF3, 7JJI and 7JWY) were taken from RCSB P |
| 27 | 6q06 | - | https://www.biorxiv.org/content/10.1101/2021.04.14.439284v1.abstract | Cryptic SARS-CoV2-spike-with-sugar interactions revealed by'universal'saturation transfer analysis | 2021 | CJ Buchanan, B Gaunt, PJ Harrison, A Le Bas, A Khan- bioRxiv, 2021 - biorxiv.org | computational modelling environments provide exact structural models. In this way, uSTA analysis provides an automated pipeline from raw NMR free induction decay (FID) signals all the way to proteinligand structures in a freely available form for the non-expert |
| 28 | 6wpt | - | https://hal.archives-ouvertes.fr/hal-03257466/document | Hyaluronic Acid-2-Deoxy-D-Glucose Conjugate Act as a Promising Targeted Drug Delivery Option for the Treatment of COVID-19 | 2021 | R Thirumalaisamy, V Aroulmoji- International, 2021 - hal.archives-ouvertes.fr | of 2DG and HA-2DG was submitted to Online SMILES convertor and Structure file generator proteases Mpro (6LU7), papain like protease PLpro (6W9C), spike protein ( 6WPT ), RNA dependent RNA polymerase (6M71) was retrieved from RCSB PDB database (https |
| 29 | 5ha4 | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/jmr.2894 | In silico prediction, molecular docking and binding studies of acetaminophen and dexamethasone to Enterococcus faecalis diaminopimelate epimerase | 2021 | H Singh, S Das, J Yadav, VK Srivastava- Journal of Molecular, 2021 - Wiley Online Library | are also available in the PDB , but are to date otherwise unpublished, including Acinetobacter baumannii ( PDB : 5HA4 ), Bacillus anthracis ( PDB : 2OTN structural and functional studies of DAP epimerase from different organisms have reported that the structure consists of |
| 30 | 3o2e | - | https://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.15447 | Phosphorylation status of BolA affects its role in transcription and biofilm development | 2021 | L Galego, S Barahona, CV Romo- The FEBS, 2021 - Wiley Online Library | NMR structure of mouse BolA1 ( PDB ID 1V60) and E. coli BolA ( PDB ID 2DHM) reveal a structure with similarity to nucleic acid binding proteins including a helix-turn [6]. MreB is a structural homologue of actin that is essential for cell elongation, maintenance of |
| 31 | 6brl | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/jimd.12387 | Metabolic impact of pathogenic variants in the mitochondrial glutamyltRNA synthetase EARS2 | 2021 | M Ni, LF Black, C Pan, H Vu, J Pei, B Ko- Journal of Inherited, 2021 - Wiley Online Library | 3A and B). Structural modeling of human EARS2 was obtained from the SWISS-MODEL Page 10. repository (Bienert et al 2017) based on the crystal structure of the glutamyl-tRNA synthetase from Elizabethkingia meningosepticum ( PDB : 6brl ), and superimposed on the crystal |
| 32 | 4wgj | 4lu4, 4py3, 4xi8 | https://royalsocietypublishing.org/doi/abs/10.1098/rsob.210009 | Fic and non-Fic AMPylases: protein AMPylation in metazoans | 2021 | BK Chatterjee, MC Truttmann- Open Biology, 2021 - royalsocietypublishing.org | name, organism name, references, function/targets, structure ( PDB ID) BepC, Bartonella henselae, [59], triggers actin stress fibre formation in HeLa cells, 4WGJ salt bridges occur between (a) Asp117 and Lys119 of the extended flap region (a -hairpin like structure that partially |
| 33 | 4gl8 | - | https://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1009180 | Host-specific functional compartmentalization within the oligopeptide transporter during the Borrelia burgdorferi enzootic cycle | 2021 | AM Groshong, MA McLain, JD Radolf- PLoS pathogens, 2021 - journals.plos.org | Structural homology models demonstrated variations within the binding pockets of OppA1, 2, and 5 indicative of different peptide repertoires We used larval immersion feeding [43] to confirm that oppA1 is essential for structural integrity of the spirochete during the blood meal |
| 34 | 6wps | - | https://academic.oup.com/glycob/advance-article-abstract/doi/10.1093/glycob/cwab... | Modernized uniform representation of carbohydrate molecules in the Protein Data Bank | 2021 | C Shao, Z Feng, JD Westbrook, E Peisach- , 2021 - academic.oup.com | glycan structures (eg, SARS-CoV-2 protein-carbohydrate complex PDB ID 6WPS ) and the partnership is committed to maintaining consistency and accuracy across the PDB archive by regularly reviewing data processing procedures and carrying out structure remediation efforts |
| 35 | 6q04 | - | https://link.springer.com/article/10.1007/s00705-021-04961-y | A comparative study of human betacoronavirus spike proteins: structure, function and therapeutics | 2021 | J Verma, N Subbarao- Archives of virology, 2021 - Springer | Coronaviruses are the paradigm of emerging 21st century zoonotic viruses, triggering numerous outbreaks and a severe global health crisis. The current COVI. |
| 36 | 5k0s | - | https://www.jbc.org/article/S0021-9258(21)00446-4/abstract | Molecular basis for diaryldiamine selectivity and competition with tRNA in a type 2 methionyl-tRNA synthetase from a Gram-negative bacterium | 2021 | GF Mercaldi, M de Oliveira Andrade- Journal of Biological, 2021 - ASBMB | In addition, XcMetRS was compared with MetRS1 enzymes in complex with dual-site inhibitors from Trypanosoma brucei (PDB code: 4EGA) (48, 67), Brucella melitensis (PDB code: 5K0S) (35, 68), and S. aureus (PDB code: 4QRD) |
| 37 | 6nb8 | - | https://www.biorxiv.org/content/10.1101/2021.04.12.439478.abstract | Epitope profiling of coronavirus-binding antibodies using computational structural modelling | 2021 | SA Robinson, MIJ Raybould, C Schneider, WK Wong- bioRxiv, 2021 - biorxiv.org | Analysis of SARS-CoV-2antibody structural complexes A total of 48 antibodies and 12 nanobodies had at least one published solved X-ray crystal structure in complex to the spike receptor binding domain (RBD, see Table S1 and Table S2 for names and PDB codes), while |
| 38 | 3u0d | - | https://www.sciencedirect.com/science/article/pii/S1093326321000309 | Acute phase 1-acid glycoprotein as a siderophore-capturing component of the human plasma: A molecular modeling study | 2021 | SA Samsonov, F Zsila, M Maszota-Zieleniak- Journal of Molecular, 2021 - Elsevier | JavaScript is disabled on your browser. Please enable JavaScript to use all the features on this page. Skip to main content Skip to article |
| 39 | 6mg6 | - | https://www.researchsquare.com/article/rs-561386/latest.pdf | Genome Mining, Phylogenetic and Structural Analysis of Bacterial Nitrilases for the Biodegradation of Nitrile Compounds | 2021 | R Salwan, V Sharma, S Das - 2021 - researchsquare.com | ( PDB :1EMS), Helicobacter pylori ( PDB : 6MG6 ), Mus musculus ( PDB : 2W1V), Pyrococcus abyssi ( PDB : 3WUY) has already been reported. However, with most of the nitrilases, the crystal structure had been resolved, came |
| 40 | 6wsa | 3ppi, 3oxk, 3kcq, 4w5k, 3sgw, 4rgb, 4ghk | https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0257318 | Principal component analysis of alpha-helix deformations in transmembrane proteins | 2021 | A Bevacqua, S Bakshi, Y Xia- PloS one, 2021 - journals.plos.org | 6tt4, 6txw, 6tzj, 6uqw, 6v47, 6vbj, 6vie, 6vjd, 6vmz, 6vnw, 6w1w, 6w2x, 6wok, 6wsa , 6x1q, 6x2m and the contribution of each physical deformation to the overall flexibility of the secondary structure N -helices of a given length (L residues) were collected from PDB entries (See |
| 41 | 6wps | 7jw0, 7jxe, 7jv2, 7k43, 7jvc | https://www.mdpi.com/965720 | Structural analysis of neutralizing epitopes of the SARS-CoV-2 spike to guide therapy and vaccine design strategies | 2021 | MT Finkelstein, AG Mermelstein, E Parker Miller- Viruses, 2021 - mdpi.com | Multiple structures of S in complex with ACE2 have been determined [9,17,21,22,26 S proteins from SARS-CoV, SARS-CoV-2, and MERS-CoV undergo dramatic structural changes to S2 forms an elongated structure , and the two heptad repeats, HR1 and HR2, eventually form a ... S2M11 from RBM Class III (PDB ID 7K43 [71]), and CR3022 (left) and S309 (right) from RBD Core (PDB IDs 6W41 [86] and PDB ID 6WPS [ |
| 42 | 3tcq | - | https://link.springer.com/article/10.1007/s00894-021-04682-8 | Targeting ebola virus VP40 protein through novel inhibitors: exploring the structural and dynamic perspectives on molecular landscapes | 2021 | S Khan, Z Fakhar, A Ahmad- Journal of Molecular Modeling, 2021 - Springer | of novel antiviral drugs. Computational methods. Structural modelling. The X-ray crystallographic structure of VP40 protein ( PDB Code: 3TCQ ) [12] was retrieved from the Protein Data Bank (www.rcsb.org). The structure was prepared |
| 43 | 5i4m | - | https://www.sciencedirect.com/science/article/pii/S0304389421000765 | Zn2+-dependent enhancement of Atrazine biodegradation by Klebsiella variicola FH-1 | 2021 | J Zhang, X Wu, X Zhang, H Pan, JES Shearer- Journal of Hazardous, 2021 - Elsevier | chloromuconate to generate maleylacetate (Cmara et al., 2008). As a major structural component in the cell wall, peptidoglycan plays important roles in cell growth. Studies have shown that three zinc-dependent endopeptidases |
| 44 | 5vn4 | - | https://www.nature.com/articles/s41598-021-91747-6 | Acyclic nucleoside phosphonates with adenine nucleobase inhibit Trypanosoma brucei adenine phosphoribosyltransferase in vitro | 2021 | E Doleelov, T Klejch, P paek, M Slapnikov- Scientific Reports, 2021 - nature.com | Acyclic nucleoside phosphonates (ANPs) represent a group of compounds whose biological activity is based on their structural resemblance to the natural nucleotides 8,9 . Their flexibility enables them to adopt a conformation suitable for the interaction with the active site ... To assess the probable binding modes of the most potent inhibitors, docking calculations were performed. Since T. brucei APRT1 has been slightly explored so far, the only experimental structure that is available for this enzyme |
| 45 | 6nb7 | 6nb6 | https://arxiv.org/abs/2101.01884 | Exploring the Regulatory Function of the N-terminal Domain of SARS-CoV-2 Spike Protein Through Molecular Dynamics Simulation | 2021 | Y Li, T Wang, J Zhang, B Shao, H Gong- arXiv preprint arXiv, 2021 - arxiv.org | taking the S proteins of SARS-CoV with 2 upward RBDs ( PDB ID: 6NB6) (21) and 3 upward RBDs ( PDB ID: 6NB7 ) (21) as We also conducted a time- structure based Independent Components Analysis (tICA) (34, 35) to identify slow motions with high time autocorrelation on |
| 46 | 6vxx | 6vyb | https://pubs.rsc.org/en/content/articlehtml/2021/ra/d0ra09555a | Interaction analyses of SARS-CoV-2 spike protein based on fragment molecular orbital calculations | 2021 | K Akisawa, R Hatada, K Okuwaki, Y Mochizuki- RSC Advances, 2021 - pubs.rsc.org | Here, we report on interaction analyses of the spike protein in both closed ( PDB -ID: 6VXX ) and open interaction energies were evaluated for both structures , and a mutual comparison indicated considerable losses of stabilization energies in the open structure , especially in |
| 47 | 6x79 | 7jv2 | https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0252571 | Molecular dynamics analysis of N-acetyl-D-glucosamine against specific SARS-CoV-2's pathogenicity factors | 2021 | Baysal, N Abdul Ghafoor, RS Silme, AN Ignatov- PloS one, 2021 - journals.plos.org | The 3' end of the genome encodes 4 major structural proteins, including the spike protein (S), the nucleocapsid protein structure of refusion SARS-CoV-2 S ectodomain trimer covalently stabilized in the closed conformation ( PDB : 6X79 ), and X-ray diffraction structure of SARS |
| 48 | 3nwo | - | https://link.springer.com/article/10.1007/s11010-021-04121-5 | The rise and fall of anandamide: processes that control synthesis, degradation, and storage | 2021 | RG Biringer- Molecular and Cellular Biochemistry, 2021 - Springer | This manuscript discusses the key enzymes in AEA homeostasis, in terms of structure , reaction specificity, enzymatic activity, regulation, and tissue and cellular expression patterns with a focus on the human isoforms involved. ... No X-ray structures or posttranslational modifications have been reported. There are two potential structural model templates suggested on the SWISS-MODEL website [14], template 3nwo.1.A and template 5mxp.1.B. hABHD4 is produced |
| 49 | 5udf | - | https://pubs.acs.org/doi/abs/10.1021/acs.chemrev.1c00055 | Structure, Assembly, and Function of Tripartite Efflux and Type 1 Secretion Systems in Gram-Negative Bacteria | 2021 | I Alav, J Kobylka, MS Kuth, KM Pos, M Picard- Chemical, 2021 - ACS Publications | Journal Logo. Structure , Assembly, and Function of Tripartite Efflux and Type 1 Secretion Systems in Gram-Negative Bacteria. Ilyas Alav Ilyas Alav. Institute of Microbiology and Infection, College of Medical and Dental Sciences |
| 50 | 6bfu | - | https://journals.asm.org/doi/abs/10.1128/JVI.02284-20 | Insight into Vaccine Development for Alphacoronaviruses Based on Structural and Immunological Analyses of Spike Proteins | 2021 | Y Shi, J Shi, L Sun, Y Tan, G Wang, F Guo- Journal of, 2021 - Am Soc Microbiol | (B) Overall structure comparison of coronavirus S-trimers. The S-trimer structures of HCoV-229E ( PDB ID: 6U7H), HCoV-NL63 ( PDB ID: 5SZS), PEDV ( PDB ID: 6U7K), FIPV ( PDB ID: 6JX7), PDCoV ( PDB ID: 6BFU ), IBV ( PDB ID: 6CV0), SARS-CoV ( PDB ID: 5X5B), SARS |
| 51 | 5tw7 | - | https://www.mdpi.com/2079-7737/10/7/594 | Discovery of Novel GMPS Inhibitors of Candidatus Liberibacter Asiaticus by Structure Based Design and Enzyme Kinetic | 2021 | J Nan, S Zhang, P Zhan, L Jiang- Biology, 2021 - mdpi.com | SwissModel was employed to generate the three-dimensional structure of CLas GMPS using Neisseria gonorrhoeae GMPS ( PDB ID: 5TW7 ) as a The homology model of the CLas GMPS structure was a dimer (Figure 1). The quality of the three-dimensional structure of CLas |
| 52 | 4o5o | - | https://academic.oup.com/peds/article-abstract/doi/10.1093/protein/gzab008/62691... | A fragment-based protein interface design algorithm for symmetric assemblies | 2021 | J Laniado, K Meador, TO Yeates- Protein Engineering, Design, 2021 - academic.oup.com | The expansive database of known protein structures provides valuable empirical frameworks for The growing focus on secondary structure associations motivates an attempt to bring by precomputing common proteinprotein fragment configurations from known structural data |
| 53 | 4nps | - | https://www.pnas.org/content/118/12/e2023245118.short | Structural basis for selective AMPylation of Rac-subfamily GTPases by Bartonella effector protein 1 (Bep1) | 2021 | N Dietz, M Huber, I Sorg, A Goepfert- Proceedings of the, 2021 - National Acad Sciences | Skip to main content. Main menu. Home; Articles: Current; Special Feature Articles - Most Recent; Special Features; Colloquia; Collected Articles; PNAS Classics; List of Issues. Front Matter: Front Matter Portal; Journal Club. News: For |
| 54 | 6q09 | - | https://www.sciencedirect.com/science/article/pii/S0003986121001673 | Diversity of structures and functions of oxo-bridged non-heme diiron proteins | 2021 | MLC Nogueira, AJ Pastore, VL Davidson- Archives of Biochemistry and, 2021 - Elsevier | Archives of Biochemistry and Biophysics. Diversity of structures and functions of oxo-bridged non-heme diiron proteins. ... Fig. 3. Examples of the different combinations of amino acid residues that coordinate the irons in hemerythrin-like proteins. A. HLP from Mycobacterium kansasii with 4H/2E/1Y coordination (PDB entry 6Q09) |
| 55 | 6bfu | - | https://jvi.asm.org/content/early/2021/01/06/JVI.02284-20.abstract | Insight into vaccine development for Alpha-coronaviruses based on structural and immunological analyses of spike proteins | 2021 | Y Shi, J Shi, L Sun, Y Tan, G Wang, F Guo- Journal of, 2021 - Am Soc Microbiol | recognition pattern, especially the structure of the RBD and its state in the S-trimer, 112 Structural and immunological analyses of alpha- and beta-coronaviruses spike 124 proteins 125 To date, multiple S-trimer structures of coronaviruses have been resolved (12-14, 126 |
| 56 | 5koi | - | https://www.sciencedirect.com/science/article/pii/S1875536421600444 | Bufotenine and its derivatives: synthesis, analgesic effects identification and computational target prediction | 2021 | Z Chao, C Min, SUN Shan-Liang, W Jiao-Jiao- Chinese Journal of, 2021 - Elsevier | Class Target PDBa Glideb MMGBSA Class Target PDB Glide MMGBSA Class Target PDB Glide MMGBSA mGLuR5 4OO9 0.52 37.15 GLP1 3IOL 4.50 23.75 NaV1.7 5KOI 2.85 25.53 silver chlor- ide is added for substitution to obtain a stable structure of compound 6 with |
| 57 | 6mg6 | - | https://www.tandfonline.com/doi/abs/10.1080/07388551.2020.1827367 | Nitrilase: a promising biocatalyst in industrial applications for green chemistry | 2021 | JD Shen, X Cai, ZQ Liu, YG Zheng- Critical Reviews in, 2021 - Taylor & Francis | 6I00), Saccharomyces cerevisiae ( PDB : 4H5U and 1F89), Pyrococcus abyssi ( PDB : 3KLC), Helicobacter pylori ( PDB : 6MG6 ) and Synechocystis ( PDB : 3WUY) has been obtained However, with most of the nitrilases, the crystal structure had been resolved, came from eukaryotes |
| 58 | 6aqz | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/prot.26080 | Crystal structure of a GDP6OMe4ketoLxyloheptose reductase from Campylobacter jejuni | 2021 | JH Kim, A Hofmann, JS Kim- Proteins: Structure, Function, and, 2021 - Wiley Online Library | Page 9. Discussion Comparison with other related proteins The crystal structure of Camylobacter MlghC revealed a two-domain architecture commonly found in 36.7; rmsd 1.9 ) and Naegleria fowleri ( PDB ID 6AQZ ; Z-score 34.3; rmsd 2.3 ), and GDP-4-keto-6 |
| 59 | 5viu | - | https://link.springer.com/article/10.1007/s12298-021-01023-0 | Identification and expression profiling of proline metabolizing genes in Arabidopsis thaliana and Oryza sativa to reveal their stress-specific transcript alteration | 2021 | S Arabia, MNA Shah, AA Sami, A Ghosh- Physiology and Molecular, 2021 - Springer | 2020) to stabilize the intracellular environment as well as the structures of proteins, membranes, and subcellular organelles (Verslues et al Data retrieval from Arabidopsis and Rice genome databases, and construction of gene structure and domain architecture |
| 60 | 6nb3 | 6q04 | https://internal-journal.frontiersin.org/articles/10.3389/fmolb.2021.607443/full | Molecular mechanisms behind anti SARS-CoV-2 action of lactoferrin | 2021 | M Miotto, L Di Rienzo, L B- Frontiers in, 2021 - internal-journal.frontiersin.org | Structural studies determined the structures of such protein both in free form and bound to ACE2 of the ACE2 receptor with SARS-CoV-2 spike receptor-binding domain, RBD ( PDB id: 6m17 ... The 10 structural analogs (as identified by TM-align Zhang and Skolnick (2005)) found by I-tasser are PDB id: 5X58, 6NZK, 6NB3, 3JCL, 5I08, 6CV0, 5SZS, 5WRG , 6UTK, 6B7N. The first (out of five) model returned |
| 61 | 5vcu | - | https://arxiv.org/abs/2102.03202 | Interpretable Neural Networks based classifiers for categorical inputs | 2021 | S Zamuner, PDL Rios- arXiv preprint arXiv:2102.03202, 2021 - arxiv.org | cartoon representation of RAS protein (green) bounded to GDP (light blue spheres) from pdb 5vcu belonging to the most relevant predicted triplets are clustered in the structure of the Note that, to better compare to plmDCA, the same architecture and hyperparameters have |
| 62 | 6q05 | - | https://www.sciencedirect.com/science/article/pii/S1093326320305672 | Exploring the intrinsic dynamics of SARS-CoV-2, SARS-CoV and MERS-CoV spike glycoprotein through normal mode analysis using anisotropic network | 2021 | S Majumder, D Chaudhuri, J Datta, K Giri- Journal of Molecular Graphics, 2021 - Elsevier | 2.1. Protein structure retrieval. All the X-ray crystal structures for SARS-CoV-2, SARS-CoV and MERS-CoV S proteins in the lying state were taken from protein data bank [21]. The corresponding PDB IDs are 6VXX, 5X58 and 6Q05 respectively [11,22,23] |
| 63 | 6wgy | 3hwk | https://www.sciencedirect.com/science/article/pii/S0141813021009077 | Structural basis of the cooperative activation of type II citrate synthase (HyCS) from Hymenobacter sp. PAMC 26554 | 2021 | SH Park, CW Lee, DW Bae, H Do, CS Jeong- International Journal of, 2021 - Elsevier | of citrate-bound HyCS (closed conformation) and apo-EcCS (open conformation, PDB code: 4G6B residues showed a face-to-edge interaction in the open state structure of EcCS citrate binding-induced conformational changes result in the transfer of further structural changes to ... Mycobacterium tuberculosis (PDB code 3HWK), has a Lys residue at the position corresponding to Trp262 of HyCS but that from the Mycobacterium tuberculosis variant bovis AF2122/97 (PDB code 6WGY) contains a Ser residue instead |
| 64 | 6q04 | - | https://www.sciencedirect.com/science/article/pii/S0024320521007608 | Evolutionary selectivity of amino acid is inspired from the enhanced structural stability and flexibility of the folded protein | 2021 | SJA Rao, NP Shetty- Life Sciences, 2021 - Elsevier | Evolutionary selectivity of amino acid is inspired from the enhanced structural stability and flexibility of the folded protein certain positions is governed by a well-orchestrated feedback mechanism, which follows increased stability and flexibility in the folded structure compared to |
| 65 | 6wpt | 6wps | https://pubs.acs.org/doi/abs/10.1021/acs.jctc.0c01144 | Structure, Dynamics, Receptor Binding, and Antibody Binding of the Fully Glycosylated Full-Length SARS-CoV-2 Spike Protein in a Viral Membrane | 2021 | YK Choi, Y Cao, M Frank, H Woo, SJ Park- Journal of chemical, 2021 - ACS Publications | The spike (S) protein of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) mediates host cell entry by binding to angiotensin-converting enzyme 2 (ACE2) and is considered the major target for drug and vaccine development. We previously built fully glycosylated full-length SARS-CoV-2 S protein models in a viral membrane ... In the cryo-EM structure of the S trimer in the complex with the S309 antibody (PDB ids: 6WPS and 6WPT(51)), S309 interacts with the glycan attached to N343. |
| 66 | 6w7x | - | http://biotech.aiijournal.com/EN/abstract/abstract13063.shtml | Biochemical Characterization and Structural Analysis of N-acetylornithine Transaminase from Synechocystis sp. PCC6803 | 2021 | F BAI, Z LI, X WANG, Z HU, L BAO- Biotechnology, 2021 - biotech.aiijournal.com | PLP PLP slr1022, 2E54, 6W7X , 2EH6 and SWISS- MODEL N- PDB ID 2E54 A: Cartoon structure of Slr1022 |
| 67 | 3tmg | 4z9n, 4f3p | https://www.biorxiv.org/content/10.1101/2021.01.27.428399v1.abstract | Gating the channel pore of ionotropic glutamate receptors with bacterial substrate binding proteins | 2021 | M Bernhard, B Laube- bioRxiv, 2021 - biorxiv.org | The bacterial GluR0 receptor was chosen due to its less complex architecture compared to eukaryotic iGluRs, characterized by the lack of an NTD, a Therefore, we used the structure of the glutamate-bound closed GluR0-LBD conformation (Mayer et al., 2001) ( PDB ID |
| 68 | 6vyb | - | https://www.mdpi.com/1034566 | Metal-Bound Methisazone; Novel Drugs Targeting Prophylaxis and Treatment of SARS-CoV-2, a Molecular Docking Study | 2021 | A Abdelaal Ahmed Mahmoud M Alkhatip- International Journal of, 2021 - mdpi.com | SARS-CoV-2 currently lacks effective first-line drug treatment. We present promising data from in silico docking studies of new Methisazone compounds (modified with calcium, Ca; iron, Fe; magnesium, Mg; manganese, Mn; or zinc, Zn) designed to bind more strongly to key proteins ... We found that the highest binding interactions were found with the spike protein (6VYB), with the highest overall binding being observed with Mn-bound Methisazone at −8.3 kcal/mol, |
| 69 | 3qh4 | - | https://www.researchsquare.com/article/rs-187084/latest.pdf | Protein Engineering for Enhanced Enantioselectivity of Carboxylesterase Est924 Toward Ethyl 2-Arylpropionates | 2021 | X Liu, M Zhao, X Fan, Y Fu - 2021 - researchsquare.com | Enhancement of the enantioselectivity of carboxylesterase A by structure -based mutagenesis. J Biotechnol Page 13. Page 13/14 PDB entry A1 A2 B1 B2 Est924 I203 A203 G208 I212 3H17 M193 V194 G198 M202 3QH4 A209 F210 A214 M218 3WJ1 F197 L198 H202 F206 |
| 70 | 6q04 | - | https://www.sciencedirect.com/science/article/pii/S1047847721000186 | Spike protein fusion loop controls SARS-CoV-2 fusogenicity and infectivity | 2021 | D Pal- Journal of Structural Biology, 2021 - Elsevier | The structural and dynamics analyses of the Spike show that its fusion loop spatially organizes three fusion peptides contiguous to each other to synergistically I propose a Contact Initiation Model based on the architecture of the Spike quaternary structure that explains the |
| 71 | 4hr2 | - | https://www.nature.com/articles/s41594-020-00530-0 | Structures of radial spokes and associated complexes important for ciliary motility | 2021 | M Gui, M Ma, E Sze-Tu, X Wang, F Koh- Nature Structural &, 2021 - nature.com | In motile cilia, a mechanoregulatory network is responsible for converting the action of thousands of dynein motors bound to doublet microtubules into a single propulsive waveform. Here, we use two complementary cryo-EM strategies to determine structures of the major |
| 72 | 6cy1 | - | https://www.sciencedirect.com/science/article/pii/S0141813020353630 | Essential biochemical, biophysical and computational inputs on efficient functioning of Mycobacterium tuberculosis H37Rv FtsY | 2021 | MK Ekka, LS Meena- International Journal of Biological Macromolecules, 2021 - Elsevier | FtsY is comprised of helices, but this structural pattern was shown to change these ligands cause significant conformational change by variating the secondary structure to transduce GTP-binding proteins. SRP signal recognition particle. PDB protein data bank. fts filamentous |
| 73 | 3qhx | 3qi6 | https://www.mdpi.com/2079-3197/9/3/32 | Pharmacophore-Guided Identification of Natural Products as Potential Inhibitors of Mycobacterium ulcerans Cystathionine -Synthase MetB | 2021 | SK Kwofie, NNO Dolling, E Donkoh, GM Laryea, L Mosi- Computation, 2021 - mdpi.com | For the study, chain A of each 3D crystal structural coordinate file was used. Two experimentally elucidated structures of CGS MetB from M. ulcerans are available. The structure with PDB ID 3QI6 is bound covalently to PLP (cofactor) and the other with PDB ID 3QHX is bound |
| 74 | 4kzp | - | https://pubs.acs.org/doi/abs/10.1021/acsinfecdis.1c00069 | Enzymatic -Oxidation of the Cholesterol Side Chain in Mycobacterium tuberculosis Bifurcates Stereospecifically at Hydration of 3-Oxo-cholest-4,22-dien-24-oyl-CoA | 2021 | T Yuan, JM Werman, X Yin, M Yang- ACS Infectious, 2021 - ACS Publications | The unique ability of Mycobacterium tuberculosis (Mtb) to utilize host lipids such as cholesterol for survival, persistence, and virulence has made the metabolic pathway of cholesterol an area of great interest for therapeutics development. Herein, we identify and characterize two genes from the Cho-region (... A search model for the apo-protein was created from 4KZP and the holo-protein model was created from the ChsB1 apo-protein model. |
| 75 | 6pqh | - | https://www.sciencedirect.com/science/article/pii/S0969212621001647 | Structural study of the N-terminal domain of human MCM8/9 complex | 2021 | J Li, D Yu, L Liu, H Liang, Q Ouyang, Y Liu- Structure, 2021 - Elsevier | Journal home page for Structure . Article. Structural study of the N-terminal domain of human MCM8/9 complex Show more Share. Cite Highlights. The heterohexameric NTD structure combined crystal structures with cryo-EM map. ...Some other structures with less than 2.0 Å RMSD include DNA-directed DNA polymerase III (PDB: 3F2B), asparagine-tRNA ligase (PDB: 6PQH), replication protein A (PDB: 2K5V), telomerase-associated protein |
| 76 | 5eks | - | http://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&auth... | In-silico three dimensional structure prediction of important Neisseria meningitidis proteins. | 2021 | M Ali, M Aurongzeb, Y Rashid- Pakistan Journal of, 2021 - search.ebscohost.com | Chain A of 3-dehydroquinate Synthase from Acinetobacter Baumannii in complex with NAD+ with PDB id 5EKS (to be published) was selected as a template structure . The template had 98% query coverage and 56% sequence identity with the target sequence |
| 77 | 6wpt | - | https://www.ncbi.nlm.nih.gov/pmc/articles/pmc8144490/ | Synthesis and cytotoxic activity of novel Indole derivatives and their in silico screening on spike glycoprotein of SARS-CoV-2 | 2021 | P Gobinath, DA Ponnusamy Packialakshmi- Frontiers in molecular, 2021 - ncbi.nlm.nih.gov | molecular protein crystal structure of spike glycoprotein of SARS-CoV-2 PDB ID 6WPT The ligand preparation module optimized the ligand 3D structure of selected molecules to remove molecular interaction analysis with selected small molecules of (1c) with 6WPT protein was |
| 78 | 5dvw | - | https://www.intechopen.com/online-first/docking-based-screening-of-cell-penetrat... | Docking-Based Screening of Cell-Penetrating Peptides with Antiviral Features and Ebola Virus Proteins as a Drug Discovery Approach to Develop a | 2021 | E Raoufi, B Bahramimeimandi- Viral, 2021 - intechopen.com | The potential reservoirs of EBOV RNA are three species of African fruit bats [3]. The genome of this virus contains a negative-strand RNA that encodes six structural and one non- structural proteins, which can be employed as potential drug targets, including transmembrane ... The structures of GP (PDBID: 5JQB), VP35 (PDBID: 3FKE), VP24 (PDBID: 4M0Q), VP30 (PDBID: 5DVW), VP40 (PDBID: 4LDB) and NP (PDBID: 4Z9P) proteins of EBOV were collected from Protein Data Bank |
| 79 | 6tys | - | https://www.biorxiv.org/content/10.1101/2021.07.09.451785.abstract | Study of Basic Local Alignment Search Tool (BLAST) and Multiple Sequence Alignment (Clustal-X) of Monoclonal mice/human antibodies | 2021 | IV Ferrari, P Patrizio- bioRxiv, 2021 - biorxiv.org | zone between 150-210 residues amino acids; with the exception of ID PDB 3I9G-3W9D 6TYS : (A potent cross-neutralizing antibody targeting the fusion glycoprotein inhibits Nipah virus and Antibodies all have the same basic structure consisting of two heavy and two light |
| 80 | 4f2n | 4f40 | https://www.recima21.com.br/index.php/recima21/article/view/148 | DOCKING MOLECULAR E AVALIAO DA ATIVIDADE ANTILEISHMANIA IN VITRO DE UM COMPLEXO METLICO DE RUTNIO COM EPIISOPILOTURINA E | 2021 | J Arajo- -Revista Cientfica Multidisciplinar-ISSN 2675-6218, 2021 - recima21.com.br | The 3D protein structures of L. major targets were obtained from the Protein Data Bank ( PDB ) database with codes 1e7w (Pteridine reductase), 5nzg (UDP-glucose Pyrophosphorylase), 5g20 (Glycyl Peptide N-tetradecanoyltransferase), 5c7p Enzimas Identificao PDB 4F2N |
| 81 | 6nb3 | - | https://pubs.acs.org/doi/abs/10.1021/acsmedchemlett.1c00263 | Discovery of Small Molecule Entry Inhibitors Targeting the Fusion Peptide of SARS-CoV-2 Spike Protein | 2021 | X Hu, CZ Chen, M Xu, Z Hu, H Guo, Z Itkin- ACS Medicinal, 2021 - ACS Publications | SARS-CoV-2 entry into host cells relies on the spike (S) protein binding to the human ACE2 receptor. In this study, we investigated the structural dynamics of the viral S protein at the fusion pept... Comparison of the FP binding pocket of the spike protein of SARS-CoV-2 (PDB 6XR8), SARS-CoV-1 (PDB 5WRG), and MERS (PDB 6NB3). The spike protein is rendered in ribbons with the FP colored in magenta and the HR1 domain in blue. |
| 82 | 6wps | - | https://www.biorxiv.org/content/10.1101/2021.01.25.427846v1.abstract | SARS-CoV-2 receptor binding mutations and antibody mediated immunity. | 2021 | M Mejdani, K Haddadi, C Pham, R Mahadevan- BioRxiv, 2021 - biorxiv.org | 39 ( PDB : 7JMP), CV07- 250 ( PDB : 6XKQ), P2B-2F6 ( PDB : 7BWJ), CV07-270 ( PDB : 6XKP), BD-368-2 ( PDB : 7CHE), and S309 ( PDB : 6WPS ) 53 Laskowski, RA PDBsum: summaries and analyses of PDB structures Fig.1: Structure of SARS-CoV-2 RBD bound to ACE2 receptor |
| 83 | 5ji5 | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8080978.3/ | Identifying potential drug targets and candidate drugs for COVID-19: biological networks and structural modeling approaches | 2021 | G Selvaraj, S Kaliamurthi, GH Peslherbe- F1000Research, 2021 - ncbi.nlm.nih.gov | Structural modeling approach to study host-SARS-CoV-2 proteins interaction and drug and similarity and with the highest resolution template automatically from PDB and then Then, the corresponding structures constructed by superimposing the modeled protein structure on to |
| 84 | 6nb3 | - | https://convite.cenditel.gob.ve/revistaclic/index.php/revistaclic/article/view/1... | Origen del SARS-CoV-2 desde una perspectiva Bioinformtica | 2021 | R Isea- Conocimiento Libre y Licenciamiento (CLIC), 2021 - convite.cenditel.gob.ve | 6NB3 1359 MERS-CoV secuencias de la glicoprotena de espcula S que han sido recopiladas en la base de datos de protenas PDB Sequence analysis and structure predition of SARS-CoV-2 accesory proteins 9b and ORF14: evolutionary analysis indicates close |
| 85 | 6vxx | - | https://academic.oup.com/nar/article-abstract/49/D1/D437/5992282 | RCSB Protein Data Bank: powerful new tools for exploring 3D structures of biological macromolecules for basic and applied research and education in fundamental | 2021 | SK Burley, C Bhikadiya, C Bi, S Bittrich- Nucleic acids, 2021 - academic.oup.com | Biology; Nucleic Acid Enzymes; RNA and RNA-protein complexes; Structural Biology; Synthetic Biology and Bioengineering; Methods Online; Surveys and Summaries; Database; Web Server. Advance articles; Submit: Author Guidelines; |
| 86 | 3swt | - | https://www.biorxiv.org/content/10.1101/2021.01.05.425418v1.abstract | Virus-associated organosulfur metabolism in human and environmental systems | 2021 | K Kieft, AM Breister, P Huss, AM Linz, E Zanetakos- bioRxiv, 2021 - biorxiv.org | oxygen binding (eg WH and H) (Knauer 198 et al., 2012). Conserved amino acid residues that are not functional are likely preserved for 199 structural features. The retention of AMGs on viral genomes despite strong selective ... Annotations of functional amino acid residues were labeled according to the Protein Data Bank (PDB, accessed January 2019) (Berman et al., 2000) with the following identification numbers: 4BZQ and 4BZP (CysC), 2GOY (CysH), 3ZEI (CysK), 3SWT (TauD), and 1RG9 (MetK). |
| 87 | 4xgi | - | https://pubs.rsc.org/en/content/articlehtml/2021/cy/d1cy00376c | Rational engineering of Acinetobacter tandoii glutamate dehydrogenase for asymmetric synthesis of l-homoalanine through biocatalytic cascades | 2021 | L Wang, S Diao, Y Sun, S Jiang, Y Liu- Catalysis Science &, 2021 - pubs.rsc.org | on the crystal structure of GluDH from Burkholderia thailandensis ( PDB ID: 4XGI , resolution: 2.0 ) in symbiosum ( PDB ID: 1AUP and 1BGV) and GluDH from Corynebacterium glutamicum ( PDB ID: 5IJZ amino acid may cause loss of the inherent stability of the hydration structure |
| 88 | 6nb3 | - | https://www.mdpi.com/1999-4915/13/8/1615 | What Binds Cationic Photosensitizers Better: Brownian Dynamics Reveals Key Interaction Sites on Spike Proteins of SARS-CoV, MERS-CoV, and SARS-CoV-2 | 2021 | V Fedorov, E Kholina, S Khruschev, I Kovalenko- Viruses, 2021 - mdpi.com | M-protein defines the shape of the viral envelope organizing CoVs assembly in the interaction with all other major structural proteins [9 Computational virology tools contribute greatly to the understanding of viral structure , infectivity and pathogenesis, and design of antiviral drugs ... The models of S-proteins of SARS-CoV and MERS-CoV were based on cryo-EM structures from the Protein Data Bank (PDB) with IDs 6NB3 and 5X58, respectively. |
| 89 | 6q07 | - | https://www.ncbi.nlm.nih.gov/pmc/articles/pmc8219949/ | In-Silico evidence for a two receptor based strategy of SARS-CoV-2 | 2021 | E Milanetti, M Miotto, L Di Rienzo- Frontiers in molecular, 2021 - ncbi.nlm.nih.gov | Complex between MERS spike protein and sialic acid: PDB code 6Q07 Unbound SARS-CoV spike protein: PDB code 6CRV We use DMS (Richards, 1977) to compute the solvent accessible surface for all proteins structure , given their x-ray structure in PDB format (Berman et al |
| 90 | 6vyb | - | https://link.springer.com/article/10.1007/s11224-020-01723-5 | Combination and tricombination therapy to destabilize the structural integrity of COVID-19 by some bioactive compounds with antiviral drugs: insights from | 2021 | HR Abd El-Mageed, DA Abdelrheem, SA Ahmed- Structural Chemistry, 2021 - Springer | SARS-CoV-2 main protease ( PDB ID: 6LU7), (5b) SARS-CoV-2 spike protein domain ( PDB ID: 6VYB ), and (5c) human entry receptor ACE2 ( PDB ID: 1R42 validation was carried out using our previously published work [36] with re-docking of the co-crystal structure (N3) as an |
| 91 | 4dz4 | - | https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0248991 | Structure of the E. coli agmatinase, SPEB | 2021 | I Chitrakar, SF Ahmed, AT Torelli, JB French- Plos one, 2021 - journals.plos.org | The first stage used the default parameters with the structure of Burkholderia thailandensis hypothetical agmatinase ( 4DZ4 ) [34] as To place the ligand in the SPEB active site, the structure of the D. radiodurans agmatinase with bound hexane-1,6-diamine ( PDB code 1WOG |
| 92 | 6nb6 | - | https://www.annualreviews.org/doi/abs/10.1146/annurev-biophys-062920-063711 | Review of COVID-19 antibody therapies | 2021 | J Chen, K Gao, R Wang, DD Nguyen- Annual review of, 2021 - annualreviews.org | S230 SARS-CoV RBD IgG = 0.06 / BLI (73) 6NB6 (73) 4.30 Three-Dimensional Structure Alignment All of the available 3D structures of the SARS-CoV-2 S-protein RBD in complex with antibod- ies are aligned to ACE2 The PDB ID of these complexes can be found in Table 1 |
| 93 | 5bq2 | - | https://www.sciencedirect.com/science/article/pii/S0223523421004177 | The Mur Enzymes Chink in the Armour of Mycobacterium tuberculosis Cell Wall | 2021 | Y Shinde, I Ahmad, S Surana, H Patel- European Journal of Medicinal, 2021 - Elsevier | Mtb Mur ligases with the same catalytic mechanism share conserved amino acid regions and structural features that can conceivably exploit for the designing of the inhibitors, which can simultaneously target more than one isoforms (MurC-MurF) of the enzyme ... According to sequence homol- ogy search using BLASTp against PBD, 06 proteins structure tem- plates (PDB ID 3SG1, 5BQ2, 3ISS, 1A2N, 1UAE, and 3R38) were picked based on sequence identity and more statistical significance, |
| 94 | 2lwk | - | https://www.biorxiv.org/content/biorxiv/early/2021/01/10/2021.01.10.426061/DC1/e... | Supporting Information for Occurrences of protonated base triples in RNA are determined by their cooperative binding energies and specific functional | 2021 | A Halder, A Jhunjhunwala, D Bhattacharyya, A Mitra - biorxiv.org | Figure S1: Context of occurrences of G(CC) H:+ Trans/W:W Cis triple (System 2). 2D representation of (A) the 5S rRNA, (B) Domain III of 25S rRNA of S. cerevisiae and (C) HDV ribozyme are shown and the structural motifs that contain (G) 3D structure of the PDB : 3KIR Chain: A |
| 95 | 6vyb | - | https://www.tandfonline.com/doi/abs/10.1080/07391102.2020.1778537 | Ethnomedicines of Indian origin for combating COVID-19 infection by hampering the viral replication: using structure-based drug discovery approach | 2021 | S Alagu Lakshmi, RMB Shafreen, A Priya- Structure and, 2021 - Taylor & Francis | CoV-2 main protease ( PDB ID: 5R82. pdb ), spike protein ( PDB ID: 6VYB . pdb ) and human In order to minimize the energy, PDB structures of the target proteins were refined through for combating COVID-19 infection by hampering the viral replication: using structure -based drug |
| 96 | 3ujh | - | https://nph.onlinelibrary.wiley.com/doi/abs/10.1111/nph.17368 | Engineering of the cytosolic form of phosphoglucose isomerase into chloroplasts improves plant photosynthesis and biomass | 2021 | F Gao, H Zhang, W Zhang, N Wang, S Zhang- New, 2021 - Wiley Online Library | in Shanghai, China. Diffraction data were processed by HKL2000 and the PGIs structure models ( PDB : 3UJH ). After cycles of auto model building (PHENIX) (Liebschner et al., 2019) and To investigate the structural basis for the dramatic activity difference between TaPGIc and |
| 97 | 3uam | - | https://academic.oup.com/plcell/advance-article-abstract/doi/10.1093/plcell/koab... | Effectors With Chitinase Activity (EWCAs), a family of conserved, secreted fungal chitinases that suppress chitin-triggered immunity | 2021 | J Martnez-Cruz, D Romero, J Hierrezuelo- The Plant, 2021 - academic.oup.com | Phytopathogenic fungi secrete effectors with chitinase activity to break down immunogenic chitin oligomers and suppress plant immunity. The other models are 3D models of crystallized proteins from Hypocrea jecorina (2VTC, glycoside hydrolase family 61 member), A. oryzae (4MAH, lytic poly- saccharide monooxygenase), E. faecalis (4A02, chitinase), and Burkholderia pseudomallei (3UAM, chitin-binding domain) |
| 98 | 6ws6 | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8095197/ | A broadly neutralizing antibody protects against SARS-CoV, pre-emergent bat CoVs, and SARS-CoV-2 variants in mice | 2021 | DR Martinez, A Schaefer, S Gobeil, D Li, G De la Cruz- bioRxiv, 2021 - ncbi.nlm.nih.gov | Open in a separate window. Figure 3. Cryo-EM structure of DH1047 The other antibodies and shown as transparent surfaces: C105 (pale cyan, Class 1, PDB ID: 6XCN and 6XCA), DH1041 (light blue, Class 2, PDB ID: 7LAA), S309 (wheat, Class 3, PDB ID: 6WS6 and 6WPT |
| 99 | 6q04 | - | https://www.biorxiv.org/content/10.1101/2021.02.09.430519v1.abstract | Transformations, Comparisons, and Analysis of Down to Up Protomer States of Variants of the SARS-CoV-2 Prefusion Spike Protein Including the UK Variant B. 1.1. 7 | 2021 | O Basidas, D Kokron, CE Henze- bioRxiv, 2021 - biorxiv.org | Clustal Omega uses a structure guided hidden Markov model (HMM) for multiple sequence alignment. Sequences were obtained directly from the PDB files across four different corona viruses SARS-CoV (6ACD) [14], SARS-CoV-2 (6VSB) [10], MERS-CoV ( 6Q04 ) [20], and |
| 100 | 4k9d | - | https://pubs.rsc.org/en/content/articlehtml/2021/ra/d0ra10119b | Thermal stability and structure of glyceraldehyde-3-phosphate dehydrogenase from the coral Acropora millepora | 2021 | AM Perez, JA Wolfe, JT Schermerhorn, Y Qian- RSC Advances, 2021 - pubs.rsc.org | The PDB validation server shows this structure to be typical of structures of comparable resolution in measures of R and number of Ramachandran, sidechain and real-space R-value Z score (RSRZ) outliers ( PDB ID 6PX2) The model used for molecular replacement was 4K9D |
| 101 | 5i0p | - | https://www.sciencedirect.com/science/article/pii/S0021925820000964 | Metallo--lactamase domain-containing protein 2 is S-palmitoylated and exhibits acyl-CoA hydrolase activity | 2021 | MIP Malgapo, JM Safadi, ME Linder- Journal of Biological Chemistry, 2021 - Elsevier | JavaScript is disabled on your browser. Please enable JavaScript to use all the features on this page. Skip to main content Skip to article |
| 102 | 6nb3 | - | https://advances.sciencemag.org/content/7/1/eabe5575.abstract | Conformational dynamics of SARS-CoV-2 trimeric spike glycoprotein in complex with receptor ACE2 revealed by cryo-EM | 2021 | C Xu, Y Wang, C Liu, C Zhang, W Han- Science, 2021 - advances.sciencemag.org | For the FP region, we first built the homology model by the Modeller tool within Chimera by using the MERS-CoV S structure (PDB: 6NB3) as template (2, 58, 59) and then used Rosetta to refine this region against the density map |
| 103 | 6cum | - | https://onlinelibrary.wiley.com/doi/abs/10.1107/S2059798321004368 | Introduction to molecular replacement: a time perspective | 2021 | E Dodson- Acta Crystallographica Section D: Structural, 2021 - Wiley Online Library | the phase error between the correct value and the phases generated from the best solution; Dphi_DM, the phase error after density modification, which was performed with Parrot, except for PDB entry 6cum , which used Rebuilt?, Yes if the test structure could be rebuilt |
| 104 | 6ws6 | - | https://www.frontiersin.org/articles/10.3389/fimmu.2021.652223/full | CAR-NK Cells Effectively Target SARS-CoV-2-Spike-Expressing Cell Lines In Vitro | 2021 | MT Ma, S Badeti, CH Chen, J Kim- Frontiers in, 2021 - frontiersin.org | Severe Acute Respiratory Syndrome Coronavirus 2 (SARS-CoV-2) is highly contagious and presents a significant public health issue. Current therapies used to treat coronavirus disease 2019 (COVID-19) include monoclonal antibody cocktail, convalescent plasma, antivirals ... Plasmid construct of S309-CAR. The SFG retroviral vector contains the S309 single chain antibody fragment (accession code 6WS6 on PDB) |
| 105 | 3rrp | - | https://www.sciencedirect.com/science/article/pii/S0141813021002270 | Characterization of class II fumarase from Schistosoma mansoni provides the molecular basis for selective inhibition | 2021 | IA Cardoso, AKL de Souza, AMG Burgess- International Journal of, 2021 - Elsevier | Highlights. The first SmFH II structure in complex with L-malate was determined at 1.85 resolution. Only two other class II structures with L-malate in active site are reported (M. tuberculosis fumarase - PDB code: 4ADL [34] and M. abscessus fumarase - PDB code: 3RRP [51]). All of them share the same close protein-ligand contacts with the equivalent amino acid residues, |
| 106 | 6wpt | - | https://advances.sciencemag.org/content/7/16/eabf3671?utm_campaign=TrendMD_1&utm... | The SARS-CoV-2 spike variant D614G favors an open conformational state | 2021 | RA Mansbach, S Chakraborty, K Nguyen- Science, 2021 - advances.sciencemag.org | 1 Structural representation of the Spike protein. (A) The Spike complex is shown in the all-down conformation. Its S1 and S2 subunits are depicted in red and blue We display the domains highlighted in the Spike structure , shown from two different perspectives ... S309 Fab binding to up-RBD was modeled by rigid-body alignment to closed-RBD and Fab interactions from PDB structure 6WPT (21), using the backbone of residues 331 to 527 for least squares fitting. |
| 107 | 6xdh | - | https://academic.oup.com/bib/article-abstract/22/2/769/6067883 | SARS-CoV-2 3D database: understanding the coronavirus proteome and evaluating possible drug targets | 2021 | AF Alsulami, SE Thomas, AR Jamasb- Briefings in, 2021 - academic.oup.com | release of the SARS-CoV-2 genome sequence in March 2020, there has been an international focus on developing target-based drug discovery, which also requires knowledge of the 3D structure of the proteome. Where there are no experimentally solved structures , our group ... (v) Nsp15 (Uridylate specific endoribonuclease)—PDB Id: 6XDH. |
| 108 | 6xdh | - | https://academic.oup.com/bib/article-abstract/22/2/1476/6146769 | A molecular modelling approach for identifying antiviral selenium-containing heterocyclic compounds that inhibit the main protease of SARS-CoV-2: an in silico | 2021 | A Rakib, Z Nain, SA Sami, S Mahmud- Briefings in, 2021 - academic.oup.com | Abstract. Coronavirus disease 2019 (COVID-19), an infectious disease caused by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), has been declar. ... For docking analysis, the following receptors were selected: PDB ID 6M3M for N protein, PDB ID 2GHV for the RBD of the S protein, PDB ID 6W9C for PLpro, PDB ID 6 M71 for RdRp, PDB ID 6ZSL for SARS-CoV-2 helicase (nsp13), 6WC1 for nsp9 RNA-replicase, and 6XDH for nsp15 |
| 109 | 6wps | 7jw0, 7k45, 7jx3, 7jv6, 7jva, 7jvc | https://pubs.rsc.org/en/content/articlehtml/2021/sc/d1sc01203g | Prediction and mitigation of mutation threats to COVID-19 vaccines and antibody therapies | 2021 | J Chen, K Gao, R Wang, GW Wei- Chemical science, 2021 - pubs.rsc.org | Our predictions are built from the X-ray crystal structure of SARS-CoV-2 S protein and ACE2 ( PDB 6M0J), 57 and various antibodies (PDBs 6WPS , 66 6XC2, 58 6XC3, 58 6XC4, 58 6XC7, 58 6XE1, 64 6XEY, 83 6XKP, 72 6XKQ, 72. |
| 110 | 4q6u | - | https://www.sciencedirect.com/science/article/pii/S1369527421000102 | PAS domains in bacterial signal transduction | 2021 | EC Stuffle, MS Johnson, KJ Watts- Current Opinion in Microbiology, 2021 - Elsevier | ad) PAS monomer structures : (a) The PAS structural prototype photoactive dimer bound to heme cofactor (Fe 3+ , PDB : 4HI4, [25]) and a liganded monomer with cyanomet heme (Fe 3+ -CN, PDB : 3VOL, [31 For clarity, b-type heme is only shown bound to the liganded structure |
| 111 | 4nbr | - | https://pubs.acs.org/doi/abs/10.1021/acs.jcim.0c01343 | PSIQUE: Protein Secondary Structure Identification on the Basis of Quaternions and Electronic Structure Calculations | 2021 | F Adasme-Carreno, J Caballero- Journal of Chemical, 2021 - ACS Publications | Inf. Model. 2021, 61, 4, 1789-1800. ADVERTISEMENT. RETURN TO ISSUEPREVComputational Chemis...Computational ChemistryNEXT. Journal Logo. PSIQUE: Protein Secondary Structure Identification on the Basis of Quaternions and Electronic Structure Calculations |
| 112 | 6ok4 | 4lsm, 4k9d | https://www.sciencedirect.com/science/article/pii/S0300908421000249 | Structure determination and analyses of the GAPDH from the parasite Schistosoma mansoni, the first one from a platyhelminth | 2021 | S Boreiko, M Silva, J Iulek- Biochimie, 2021 - Elsevier | The GAPDH’s structures selected for sequence alignment were from: Brugia malayi, Bmal - PDB ID: 4K9D ... and Chlamydia trachomatis, Ctra - PDB ID: 6OK4 [66] |
| 113 | 4qji | - | https://www.nature.com/articles/s41467-020-20224-x | Inhibiting Mycobacterium tuberculosis CoaBC by targeting an allosteric site | 2021 | V Mendes, SR Green, JC Evans, J Hess- Nature, 2021 - nature.com | Coenzyme A (CoA) is a fundamental co-factor for all life, involved in numerous metabolic pathways and cellular processes, and its biosynthetic pathway has raised substantial interest as a drug target against multiple pathogens including Mycobacterium tuberculosis. The biosynthesis |
| 114 | 5i1f | - | https://www.jbc.org/article/S0021-9258(21)00156-3/abstract | Bacillus subtilis YngB contributes to wall teichoic acid glucosylation and glycolipid formation during anaerobic growth | 2021 | CH Wu, J Rismondo, RML Morgan, Y Shen- Journal of Biological, 2021 - ASBMB | Section of Structural and Synthetic Biology, Department of Infectious Disease, Imperial College London, London, United Kingdom The crystal structure of YngB revealed that the protein has the typical fold and all necessary active site features of a functional UGPase |
| 115 | 4npc | - | https://www.sciencedirect.com/science/article/pii/S135951132100088X | Characterization of xylitol 4-dehydrogenase from Erwinia aphidicola and its co-expression with NADH oxidase in Bacillus subtilis | 2021 | M Li, W Zhu, Q Meng, M Miao, T Zhang- Process Biochemistry, 2021 - Elsevier | XDH, EC 1.1.1.B19) catalyzes the interconversion of xylitol and l-xylulose [11], and its primary structure is highly Computer simulation and analysis facilitated the extraction of potential structural information, which may help us further investigate the catalytic mechanism of XDH ... and the crystal structure of sorbitol dehydrogenase from Brucella suis as a template (PDB ID: 4NPC). The quality of the model was evaluated using the SAVES server. Molecular docking was conducted using Autodock |
| 116 | 5ig2 | 3tjr | https://search.proquest.com/openview/6df7bf07391cd00cac2afea7f02e6375/1?pq-origs... | Structural Genomics of Infectious Agents | 2021 | JS Alenazi - 2021 - search.proquest.com | 4 1.3.5 Deposition of Structure in PDB ..... 4 identity to SDR from B.phymatum ( 5ig2 ) .... 45 S.3.2 Targeted approach of structure genomics can be applied to select the biologically important proteins |
| 117 | 4jv3 | 4f32 | https://pubs.acs.org/doi/abs/10.1021/acsmedchemlett.0c00653 | Semisynthesis and Biological Evaluation of Platencin Thioether Derivatives: Dual FabF and FabH Inhibitors against MRSA | 2021 | Y Li, X Weng, Y Deng, J Pan, S Zhu- ACS medicinal, 2021 - ACS Publications | The discovery and clinical use of multitarget monotherapeutic antibiotics is regarded as a promising approach to reduce the development of antibiotic resistance. Platencin (PTN), a potent natural a... On the basis of the X-ray structures of PTN with ecFabF(C163Q), Burkholderia vietnamiensis FabF, and Brucella melitensis FabB (PDB IDs 3HO2, 4F32, and 4JV3, respectively) as well as that of platencin A1 with ecFabF-(C163Q) (PDB ID 3HO9), it is likely that these PTN derivatives may also interact with FabF or |
| 118 | 4f4h | 6mg6, 5kha | https://www.mdpi.com/1095248 | Crystal Structure of Nitrilase-Like Protein Nit2 from Kluyveromyces lactis | 2021 | C Jin, H Jin, BC Jeong, DH Cho, HS Chun, WK Kim- Crystals, 2021 - mdpi.com | On Novel Copper Based Alloys Development via Friction Stir Alloying... The corresponding C-terminal region is shown in red. The six homologous structures indicate the following: BtGlu-dep_NAD+ synthetase: glutamine dependent NAD+ synthetase from Burkholderia thailandensis (PDB code, 4F4H). .. The two homologous structures indicate the following: HpCN hydrolase: CN hydrolase from Helicobacter pylori (PDB code, 6MG6) |
| 119 | 6wpt | 7jw0, 7jv6, 7k4n, 7k43, 7jvc | https://www.nature.com/articles/s41422-021-00487-9 | Structural basis for bivalent binding and inhibition of SARS-CoV-2 infection by human potent neutralizing antibodies | 2021 | R Yan, R Wang, B Ju, J Yu, Y Zhang, N Liu, J Wang- Cell research, 2021 - nature.com | Neutralizing monoclonal antibodies (nAbs) to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) represent promising candidates for clinical intervention against coronavirus disease 2019 (COVID-19). We isolated a large number of nAbs from SARS-CoV-2-infected ... Besides, there are some special antibodies that can compete ACE2 binding while bind to RBD with different patterns. We assigned these antibodies into class IV which contains S309 (PDB code: 6WPT), C110 (PDB code: 7K8V) and C135 (PDB code |
| 120 | 6u94 | - | https://www.biorxiv.org/content/10.1101/2021.08.17.456619.abstract | Genome sequencing of 196 Treponema pallidum strains from six continents reveals additional variability in vaccine candidate genes and dominance of Nichols clade | 2021 | NAP Lieberman, MJ Lin, H Xie, L Shretha, T Nguyen- bioRxiv, 2021 - biorxiv.org | guided by the top 1-7 templates for each target. We used the following templates in modelling each target: TP0136 used 4a2l and 5oj5; TP0326 used 4k3b and 5d0o; TP0548 used 6h3i; TP0966 used 1yc9, 3d5k, 4k7r, 4mt0, 4mt4, 5azs, and 6u94; TP0967 used 1yc9, 3d5k, 5azp, 5azs, and 6u94. |
| 121 | 4ix8 | - | https://link.springer.com/protocol/10.1007/978-1-0716-1036-7_12 | Mustguseal and Sister Web-Methods: A Practical Guide to Bioinformatic Analysis of Protein Superfamilies | 2021 | D Suplatov, Y Sharapova, V vedas- Multiple Sequence Alignment, 2021 - Springer | etc.): 3WGB, 2W7E, 3A2B, 1IBJ, 1LKC, 1 V72, 2BKW, 2EZ2, 4IX8 , 1QZ9, 4BA5 The missing loop regions in these PDB structures were reconstructed using the MODELLER software [23] enzymes, the MATT algorithm was used to prepare the initial 3D- structure superimposition of -- This is not a duplicate of their earlier 2018 work |
| 122 | 5umh | - | https://pubs.acs.org/doi/abs/10.1021/acs.jcim.0c00802 | Estimating Change in Foldability Due to Multipoint Deletions in Protein Structures | 2020 | A Banerjee, A Kumar, KK Ghosh- Journal of Chemical, 2020 - ACS Publications | Figure S6: Root mean-square fluctuation of each residue of the protein in its original conformation (in magenta) and of the protein subject to MPD in residue stretches in the nonloop region (in sea green) for PDB IDs: 4XGQ chain A, 5UMH chain A, 4A5M chain A, 3GUD chain A, and... |
| 123 | 4q4l | - | https://pubs.acs.org/doi/abs/10.1021/acs.orglett.0c01922 | Design and Synthesis of Near-Infrared Mechanically Interlocked Molecules for Specific Targeting of Mitochondria | 2020 | RS Das, PC Saha, N Sepay, A Mukherjee- Organic, 2020 - ACS Publications | The entrapment of squaraine (SQ) within a molecular container to form rotaxane has been shown to improve the dye stability and the fluorescence proficiency inside the mitochondria. The macrocycle p... The molecular docking of MSQ with Cys exposed mitochondrial protein ATP synthase subunit beta 1 (PDB: 4Q4L), and other SH-exposed proteins showed interactions between the SH moieties and MSQ |
| 124 | 6ona | - | https://onlinelibrary.wiley.com/doi/abs/10.1111/tbed.13944 | Evolution of H9N2 avian influenza viruses in Iran, 20172019 | 2020 | M Bashashati, DH Chung- Transboundary and, 2020 - Wiley Online Library | (http://www.cbs.dtu.dk/services/NetNGlyc/) and GlyProt server (http://www.glycosciences.de/ modeling/). The HA structure was modelled using the H9 HA template ( PDB accession number, 6ONA ) in the SWISS-MODEL server (https://swissmodel.expasy.org/) and |
| 125 | 3ngj | - | http://www.jbc.org/content/295/2/597.short | Rational engineering of 2-deoxyribose-5-phosphate aldolases for the biosynthesis of (R)-1, 3-butanediol | 2020 | T Kim, PJ Stogios, AN Khusnutdinova, K Nemr- Journal of Biological, 2020 - ASBMB | DERA structures as the best matches, including the Entamoeba histolytica DeoC ( PDB code 3NGJ ; Z score RMSD, 0.6 ; 66% sequence identity), and L. brevis DERA E78K mutant ( PDB code 4XBS; Z Based on the BH1352 structure , its active site is located inside of the -barrel |
| 126 | 6q06 | - | https://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1008943 | Convergent structural features of respiratory syncytial virus neutralizing antibodies and plasticity of the site V epitope on prefusion F | 2020 | W Harshbarger, S Tian, N Wahome, A Balsaraf- PLoS, 2020 - journals.plos.org | ]To fully elucidate the RSB1 paratope and the targeted PreF epitope architecture and better understand the competition with multiple antigenic sites, we determined the crystal structure of the ... Surface potential around PreF residue Asn200 from the structure of RSV B PreF PDB 6Q06 (left), with the RSB1 interacting residue Arg53(LCDR2) is shown again for comparison |
| 127 | 6nb6 | - | https://www.biorxiv.org/content/10.1101/2020.04.03.024885v1.abstract | Rapid in silico design of antibodies targeting SARS-CoV-2 using machine learning and supercomputing | 2020 | T Desautels, A Zemla, E Lau, M Franco, D Faissol- BioRxiv, 2020 - biorxiv.org | In the absence of a known SARS-CoV-2 spike protein structure , we characterized the SARS-CoV- 2 surface glycoprotein sequence YP_009724390.1 [13 The structures of the spike proteins from SARS-CoV-1 (Protein Data Bank ( PDB ) entries: 5x58 [15], 6nb6 [10], 2dd8 [11 |
| 128 | 5u4s | - | https://www.sciencedirect.com/science/article/pii/S0041008X20305093 | Species-specific differences in the inhibition of 11-hydroxysteroid dehydrogenase 2 by itraconazole and posaconazole | 2020 | SG Inderbinen, M Zogg, M Kley, M Smieko- Toxicology and Applied, 2020 - Elsevier | models were based on the template structure of 11-HSD1 (various PDB IDs), one model on the template structure of 3-oxoacyl-[acyl-carrier-protein] reductase ( PDB ID: 3u9l) and finally one on the template structure of a putative short chain dehydrogenase ( PDB ID: 5u4s ) |
| 129 | 6q06 | - | https://www.sciencedirect.com/science/article/pii/S0924857920301102 | Structural and molecular modelling studies reveal a new mechanism of action of chloroquine and hydroxychloroquine against SARS-CoV-2 infection | 2020 | J Fantini, C Di Scala, H Chahinian, N Yahi- International journal of, 2020 - Elsevier | N-acetylneuraminic acid (Neu5Ac) was generated with the Hyperchem database. 9-O-acetyl-N-acetylneuraminic acid (9-O-SIA) was retrieved from pdb file 6Q06 [18] Its three-dimensioanl structure was retrieved from pdb file # 4V2O [19] |
| 130 | 6q09 | - | https://pubs.acs.org/doi/abs/10.1021/acsomega.0c03338 | Correlation of Conservation of Sequence and Structures of Mycobacterial Hemerythrin-like Proteins with Evolutionary Relationship and Host Pathogenicity | 2020 | Z Ma, ML Caldas Nogueira, DP Marchi-Salvador- ACS, 2020 - ACS Publications | Journal Logo. Correlation of Conservation of Sequence and Structures of Mycobacterial Hemerythrin-like Proteins with Evolutionary Relationship and Host Pathogenicity. Zhongxin Ma Zhongxin Ma. Burnett School of Biomedical |
| 131 | 4ohc | - | http://bq.facmed.unam.mx/tab/wp-content/uploads/2020/06/9-Gonzalez-Segura.pdf | Orotato fosforribosiltransferasa. Pasado, presente y futuro en el estudio estructural de las protenas. | 2020 | L Gonzlez-Segura, EI Carrizosa-Carbajal - bq.facmed.unam.mx | Past, present and future in the structural study of proteins Key words: Phosphoribosyltransferase; three- dimensional structure ; conformational change; inhibition; pyrimidines synthesis str (PDBs 3M3H y 4RV4), de Burkholderia cenocepacia ( PDB 4OHC ), de Corynebacterium |
| 132 | 4ohc | - | https://pubs.acs.org/doi/abs/10.1021/acscatal.9b05294 | Elucidating the Catalytic Reaction Mechanism of Orotate Phosphoribosyltransferase by means of X-ray Crystallography and Computational Simulations | 2020 | M Roca, S Navas-Yuste, K Zinovjev- ACS, 2020 - ACS Publications | Then, the dimeric architecture of OPRTase plays an essential role in the catalysis since The coordinates and structure factors have been deposited in the Protein Data Bank ( PDB ) with accession codes 6TAI (EcOPRT), 6TAJ (EcOPRT/OA) and 6TAK (EcOPRT/OA/SO4 2-). 2.5 |
| 133 | 5ucm | - | https://link.springer.com/article/10.1007/s10930-020-09910-3 | Effects of Distal Mutations on Prolyl-Adenylate Formation of Escherichia coli Prolyl-tRNA Synthetase | 2020 | J Zajac, H Anderson, L Adams, D Wangmo, S Suhail- The Protein, 2020 - Springer | Identifying and understanding how these catalytic residues help enzymes achieve enormous rate enhancement has been the focus of many structural and biochemical studies over the past several decades Fig. 1 figure1. Structural model of E. coli ProRS |
| 134 | 5k85 | 5ifi | https://www.nature.com/articles/s41467-020-14301-4 | ProtCID: A data resource for structural information on protein interactions | 2020 | Q Xu, RL Dunbrack- Nature communications, 2020 - nature.com | While the structure of full-length activated PAH has not been determined, a recent structure of the ACT domain of J9VFT1_CRYNH, E5XP76_9ACTN) and two common entries ( PDB : 5IFI [https://doi.org/10.2210/pdb5IFI/ pdb ] and 5K85 [https://doi.org/10.2210/pdb5K85/ pdb ]) |
| 135 | 6q05 | - | https://biointerfaceresearch.com/wp-content/uploads/2020/05/2069583710560396057.... | Evaluation of Coronavirus families & Covid-19 proteins: molecular modeling study | 2020 | M Monajjemi, S Shahriari- Biointerface Res. Appl, 2020 - biointerfaceresearch.com | Several Proteins, receptors, S proteins including s1 and s2 such as 6LU7, 6Q05 , 4oW0, 6nur The Structure Preparation modules of MOE were used to correct PDB inconsistencies and to assign the structural knowledge of the CoV-RNA synthesis complexes was a structure of the |
| 136 | 6q05 | - | https://www.sciencedirect.com/science/article/pii/S0022283620302874 | Phylogenetic analysis and structural modeling of SARS-CoV-2 spike protein reveals an evolutionary distinct and proteolytically sensitive activation loop | 2020 | JA Jaimes, NM Andr, JS Chappie, JK Millet- Journal of molecular, 2020 - Elsevier | Volume 432, Issue 10, 1 May 2020, Pages 3309-3325. Journal home page for Journal of Molecular Biology. Phylogenetic Analysis and Structural Modeling of SARS-CoV-2 Spike Protein Reveals an Evolutionary Distinct and Proteolytically Sensitive Activation Loop |
| 137 | 6q05 | - | https://www.nature.com/articles/s41467-020-16876-4 | Cryo-EM structures of HKU2 and SADS-CoV spike glycoproteins provide insights into coronavirus evolution | 2020 | J Yu, S Qiao, R Guo, X Wang- Nature communications, 2020 - nature.com | structures of HKU2 and SADS-CoV spike glycoproteins provide insights into coronavirus evolution. Download PDF. Article; Open Access; Published: 17 June 2020. Cryo-EM structures of HKU2 and SADS-CoV spike glycoproteins provide insights into coronavirus evolution |
| 138 | 6q04 | - | https://www.nature.com/articles/s41594-020-0479-4 | Controlling the SARS-CoV-2 spike glycoprotein conformation | 2020 | R Henderson, RJ Edwards, K Mansouri- Nature structural &, 2020 - nature.com | d, The SARS-2 (left, PDB 6VXX) and MERS (right, PDB 6Q04 ) structures , each with a single protomer depicted in cartoon of the gj angles and dihedrals overlaid on an alignment between a SARS-2 down (cartoon structure with black centroids and lines; PDB 6VXX) and |
| 139 | 4wny | - | https://www.biorxiv.org/content/10.1101/2020.10.03.324806v1.abstract | A Universal Stress Protein upregulated by hypoxia may contribute to chronic lung colonisation and intramacrophage survival in cystic fibrosis | 2020 | A O'Connor, R Berisio, M Lucey, K Schaffer, S McClean- bioRxiv, 2020 - biorxiv.org | abilities. 253 To identify structural determinants responsible for the different behaviours of USP76 and 254 USP92, in particular their different abilities to bind to epithelial cells, we used homology 255 modelling and analysed resulting structures the best template was the BupsA stress protein from Burkholderia pseudomallei (PDB code 563 4wny, seqid 69.2%). |
| 140 | 6nb6 | 6nb7, 6nb8, 6q05 | https://www.ncbi.nlm.nih.gov/pmc/articles/pmc7074424/ | Drug targets for corona virus: A systematic review | 2020 | M Prajapat, P Sarma, N Shekhar, P Avti- Indian journal of, 2020 - ncbi.nlm.nih.gov | inhibition property.[39] The structure (protein data bank [ PDB ] ID 5ZUV and 5ZVM) shows a stable 6-helix bundle structure with S230 antibody Fab fragment binds to the SARS-CoV complex to neutralize it, and their structures are also available ( PDB IDs: 6NB6 , 6NB7, and |
| 141 | 6nae | - | https://www.preprints.org/manuscript/202003.0183 | Two Achilles' Heels of the Ebolavirus Glycoprotein? | 2020 | W Li - 2020 - preprints.org | in complex with a broadly neutralizing human antibody, adi-15946 31 6NAE Crystal Structure Structure of ZEBOV GP in complex with 3T0265 antibody 36 6S8J Structure of ZEBOV 1. Experimentally determined Ebolavirus GP structures inside Protein Data Bank ( PDB [128]) as |
| 142 | 6tz8 | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7669531/ | Current Challenges and Opportunities in Designing ProteinProtein Interaction Targeted Drugs | 2020 | WH Shin, K Kumazawa, K Imai- and Applications in, 2020 - ncbi.nlm.nih.gov | Phase Reached*, Modality*, Drug PDB ID**, Drug-Protein PDB ID*, Target PPI PDB ID binding protein 1A inhibitor, Inhibitor, Approved (1994), Small molecule, FK5, 1BKF, 6TZ8 (FKBP12/CNA 2.8 resolution by cryo-electron microscopy (cryo-EM).65 The cryo-EM structure revealed ... 6TZ8 (FKBP12/CNA/CNB) (C. neoformans) |
| 143 | 5unb | - | https://www.sciencedirect.com/science/article/pii/S0091674919316021/pdf?md5=51ff... | Janus kinase inhibition for autoinflammation in patients with DNASE2 deficiency | 2020 | Y Hong, M Capitani, C Murphy, S Pandey- Journal of Allergy and, 2020 - Elsevier | Structural modelling Structural models and figures were prepared using the ICM software package (Molsoft). A homology model for human DNase II was prepared using the existing structure from Burkholderia thailandensis ( PDB 5unb ) as the model template |
| 144 | 5trw | 5tqi | https://www.sciencedirect.com/science/article/pii/S0141813019377980 | Structural attributes and substrate specificity of pyridoxal kinase from Leishmania donovani | 2020 | S Are, S Gatreddi, P Jakkula, IA Qureshi- International Journal of Biological, 2020 - Elsevier | with ADP pyridoxamine, ADP pyridoxine, ADP ginkgotoxin and ADP alone have also been determined to provide structural insights of The initial phases of LdPdxK-ADP structure were obtained using the coordinates of sheep brain pyridoxal kinase ( PDB code 1LHP; 38 |
| 145 | 4xgi | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7326016/ | Structural studies of glutamate dehydrogenase (isoform 1) from Arabidopsis thaliana, an important enzyme at the branch-point between carbon and nitrogen | 2020 | M Grzechowiak, J Sliwiak, M Jaskolski- Frontiers in Plant, 2020 - ncbi.nlm.nih.gov | vertebrate, and fungal GDHs have been deposited in the Protein Data Bank ( PDB ) In the present study, we report the crystal structure of AtGDH1 in apo form, as To provide background for functional and structural discussions, we investigated the evolutionary divergence of the |
| 146 | 6tys | - | https://repositorio.ufopa.edu.br/jspui/handle/123456789/332 | Planejamento de protenas imunognicas multi-eptopo visando o desenvolvimento de uma vacina de nova gerao para a infeco do vrus Nipah | 2020 | JMP GALCIO - 2020 - repositorio.ufopa.edu.br | -defensin adjuvants were also added to the structural models to increase immunogenicity The interactions between each predicted epitope and MHC-I and MHC- II structures were also analyzed, using molecular modeling P Fosfoprotena PDB Protein Data Bank |
| 147 | 6vxx | - | https://pubs.acs.org/doi/abs/10.1021/acs.jpcb.0c04553 | Developing a fully glycosylated full-length SARS-CoV-2 spike protein model in a viral membrane | 2020 | H Woo, SJ Park, YK Choi, T Park- The Journal of, 2020 - ACS Publications | This technical study describes all-atom modeling and simulation of a fully glycosylated full-length SARS-CoV-2 spike (S) protein in a viral membrane. First, starting from PDB: 6VSB and 6VXX, full-l... |
| 148 | 6vxx | - | https://www.nature.com/articles/s41392-020-00392-4 | Bimodular effects of D614G mutation on the spike glycoprotein of SARS-CoV-2 enhance protein processing, membrane fusion, and viral infectivity | 2020 | X Jiang, Z Zhang, C Wang, H Ren, L Gao- Signal transduction and, 2020 - nature.com | structure of S glycoprotein, we performed three-dimensional (3D) modeling with the template of published SARS-CoV-2 S structure ( 6vxx . pdb ) by the idea that the D614G mutation may affect the stability of the S protein trimer as suggested above based on structural analysis (Fig |
| 149 | 3khp | - | https://link.springer.com/content/pdf/10.1186/s12866-020-01763-1.pdf | Proteinprotein interaction of Rv0148 with Htdy and its predicted role towards drug resistance in Mycobacterium tuberculosis | 2020 | G Bhargavi, S Hassan, S Balaji, SP Tripathy- BMC microbiology, 2020 - Springer | Rv0148 and Htdy interaction analysis The crystallographically determined structure of Htdy ( PDB code 3KHP ) and the predicted model structure of Rv0148 were used for docking using the ClusPro server b Ramachandran plot for the predicted model structure of Rv0148 |
| 150 | 6vxx | - | https://pubs.acs.org/doi/abs/10.1021/acsmedchemlett.0c00410 | Structural impact of mutation D614G in SARS-CoV-2 spike protein: enhanced infectivity and therapeutic opportunity | 2020 | A Fernndez- ACS medicinal chemistry letters, 2020 - ACS Publications | Figure 1. Structural and epistructural interactions at the S1/S2 interface in the spike protein of SARS-CoV-2. (a) Positioning of D614 in the S1 chain (magenta) relative to T859 in the S2 chain (blue) at the S1/S2 interface for the spike protein structure reported in PDB6VXX |
| 151 | 4g7f | 4lsm, 4fzi, 4iv5 | https://link.springer.com/content/pdf/10.1007/s10863-020-09834-8.pdf | Synthesis of new N,S-acetal analogs derived from juglone with cytotoxic activity against Trypanossoma cruzi | 2020 | PAF Pacheco, T de Menezes Ribeiro- Journal of Bioenergetics, 2020 - Springer | Naphthoquinones are considered important structures in medicinal chemistry due to their synthetic versatility and their v.1.0.1 program was used to build the molec- ular structure of ligands the best SI value among all molecules tested indicating that this structural feature might |
| 152 | 6vyb | - | https://pdfs.semanticscholar.org/7a8c/b4cb523ba6ce60d7e87c02e8558c13363b41.pdf | Comparative docking studies on curcumin with COVID-19 proteins | 2020 | R Suravajhala, A Parashar, B Malik, VA Nagaraj - 2020 - pdfs.semanticscholar.org | were subjected to a 3D structure generation on CORINA [12] using their SMILE Preparation of proteins and grid parameters: The protein data bank ( PDB ) structures of different proteins were retrieved from RCSB membrane protein (6M17), polymerase (6M71), spike ( 6VYB ) |
| 153 | 6vyb | - | https://link.springer.com/article/10.1007/s11224-020-01586-w | Destabilizing the structural integrity of COVID-19 by caulerpin and its derivatives along with some antiviral drugs: An in silico approaches for a combination | 2020 | SA Ahmed, DA Abdelrheem, HR Abd El-Mageed- Structural Chemistry, 2020 - Springer | Protein preparation. The 3D crystal structure of the SARS-CoV-2 main protease Mpro ( PDB ID: 6LU7) and the cryo-electron microscopic structure of the SARS-CoV-2 spike protein Sp ( PDB ID: 6VYB ) were taken from the PDB (Protein Data Bank) site |
| 154 | 5upg | - | https://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.0c01215 | Fragment-Based Discovery of Novel Non-Hydroxamate LpxC Inhibitors with Antibacterial Activity | 2020 | Y Yamada, H Takashima, DL Walmsley- Journal of Medicinal, 2020 - ACS Publications | UDP-3-O-acyl-N-acetylglucosamine deacetylase (LpxC) is a zinc metalloenzyme that catalyzes the first committed step in the biosynthesis of Lipid A, an essential component of the cell envelope of Gr... Figure 3. Detail of the crystal structure (PDB code: 5UPG) of 1 (PF-5081090) binding to the active site of PaLpxC |
| 155 | 6bfu | 6nb4 | https://www.biorxiv.org/content/10.1101/2020.03.04.976258v1.abstract | Cryo-electron microscopy structure of the SADS-CoV spike glycoprotein provides insights into an evolution of unique coronavirus spike proteins | 2020 | S Ouyang- BioRxiv, 2020 - biorxiv.org | lower and outer side of S1-CTDs arranged as a big triangle. This architecture , 157 ie, CTD sandwiched by its own NTD and the adjacent NTD, comes into being 158 189 (G). Cryo-EM structure of SADS-CoV S monomeric subunit. The structural 190 |
| 156 | 3eiy | - | https://www.biorxiv.org/content/10.1101/2020.07.15.204701v1.abstract | Graphein-a Python Library for Geometric Deep Learning and Network Analysis on Protein Structures | 2020 | AR Jamasb, P Li, T Blundell- bioRxiv, 2020 - biorxiv.org | Figure 1. Example outputs from Graphein. A Example protein surface ( 3eiy ). B Example node feature matrix for the residue-level graphs outlined The interaction status data and structure originate from structures of the complexes in the RCSB PDB |
| 157 | 3p3a | 4lw8, 3hzu | https://onlinelibrary.wiley.com/doi/abs/10.1002/prot.25874 | Challenges and opportunities of automated proteinprotein docking: HDOCK server versus human predictions in CAPRI Rounds 3846 | 2020 | Y Yan, J He, Y Feng, P Lin, H Tao- Proteins: Structure, 2020 - Wiley Online Library | prediction of this dimer interface is expected. For T144, the TPC1 channel structures of mouse ( PDB ID: 6C9A) and Arabidopsis thaliana ( PDB ID: 5DQQ) were used as the templates to construct the human TPC2 channel structure ( PDB ID: 6NQ0). Despite the low sequence |
| 158 | 6wps | - | https://www.nature.com/articles/s41598-020-71748-7 | Analysis of the SARS-CoV-2 spike protein glycan shield reveals implications for immune recognition | 2020 | OC Grant, D Montgomery, K Ito, RJ Woods- Scientific reports, 2020 - nature.com | The 3D structures show that the protein surface is extensively shielded from antibody recognition by glycans, with the notable exception of the ACE2 receptor Here we examine the structure of the SARS-CoV-2 envelope spike (S) protein that mediates host cell infection, with a. ... However, a closer examination also indicates a contraction between the 3D glycoform model and the observed binding of the neutralizing antibody S309 (PDB ID 6WPS). |
| 159 | 6nb4 | 6nb7 | https://apjai-journal.org/wp-content/uploads/2020/03/2.pdf | Perspectives on monoclonal antibody therapy as potential therapeutic intervention for Coronavirus disease-19 (COVID-19) | 2020 | B Shanmugaraj, K Siriwattananon- Asian Pac J Allergy, 2020 - apjai-journal.org | PDB ID 6CS2)72 and the following antibodies are shown in magenta: 80R ( PDB ID 2GHW)73, F26G1 ( PDB ID 3BGF)74, m396 ( PDB ID 2DD8)75, and S230 ( PDB ID 6NB7 (P D B ID 6NB4 ) Structure of SARS coronavirus spike receptor- binding domain complexed with receptor |
| 160 | 6wpt | - | https://www.nature.com/articles/s41467-020-18058-8 | A cross-reactive human IgA monoclonal antibody blocks SARS-CoV-2 spike-ACE2 interaction | 2020 | M Ejemel, Q Li, S Hou, ZA Schiller, JA Tree- Nature, 2020 - nature.com | COVID-19 caused by SARS-CoV-2 has become a global pandemic requiring the development of interventions for the prevention or treatment to curtail mortality and morbidity. No vaccine to boost mucosal immunity, or as a therapeutic, has yet been developed to SARS-CoV-2. ... However, this predicted epitope of MAb362 is different from the other recently reported MAb complexes to the SARS-CoV-2-RBD (Fig. 3c and Supplementary Fig. 5), including: CR302217 (PDB: 6W41); S30916 (PDB: 6WPT); REGN10933 and REGN1098725; |
| 161 | 6wps | 6wpt | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7586990/ | Immunological strategies against spike protein: Neutralizing antibodies and vaccine development for COVID19 | 2020 | J Huang, H Huang, D Wang, C Wang- Clinical and, 2020 - ncbi.nlm.nih.gov | Structural data of RBD of SARSCoV2 S protein with CR3022 Fab was retrieved from Protein Databank. (C) Structure of SARSCoV2 S protein with neutralizing antibody S309 Fab fragment ( PDB : 6WPS ) is shown in close state |
| 162 | 6wpt | - | https://www.sciencedirect.com/science/article/pii/S0165614720301668 | Fruitful neutralizing antibody pipeline brings hope to defeat SARS-Cov-2 | 2020 | A Renn, Y Fu, X Hu, MD Hall, A Simeonov- Trends in pharmacological, 2020 - Elsevier | and a receptor-binding subdomain also referred to as receptor binding motif (RBM, residues 438505) which loops out of the core domain structure to directly The structures used for superimposition of S309 and CR3022 are with RBD of SARS-CoV-2 ( PDB 6WPT [41] and |
| 163 | 3eiy | - | https://arxiv.org/abs/2012.05716 | Utilising Graph Machine Learning within Drug Discovery and Development | 2020 | T Gaudelet, B Day, AR Jamasb, J Soman- arXiv preprint arXiv, 2020 - arxiv.org | and evolve along a temporal dimension resulting in changes to composition, structure and attributes One such approach is to use a graph's structural information to regularise embeddings authors suggest the atten- tion mechanism is decoupled from the architecture and should |
| 164 | 6x79 | - | https://pubs.acs.org/doi/abs/10.1021/acsomega.0c03512 | Characterization of the SARS-CoV-2 S protein: biophysical, biochemical, structural, and antigenic analysis | 2020 | NG Herrera, NC Morano, A Celikgil, GI Georgiev- ACS, 2020 - ACS Publications | need to produce large quantities of high-quality SARS-CoV-2 Spike (S) protein for use in both clinical and basic science settings. To address this need, we have evaluated the expression and purification of two previously reported S protein constructs in Expi293F and ExpiCHO-S cells... In nine structures that align well in this region (conformation 1: 6VXX, 6X29, 6X2C, 6X79, 6ZOX, 6ZOY, 6ZP0, 6ZP1, 6ZWV), the amino acid segment 621–640 was not modeled, presumably due to disorder |
| 165 | 3jvi | - | https://link.springer.com/protocol/10.1007/978-1-0716-0163-1_1 | In Silico Laboratory: Tools for Similarity-Based Drug Discovery | 2020 | S Lenik, J Konc- Targeting Enzymes for Pharmaceutical Development, 2020 - Springer | The output file 1phrA_3jviA.0.rota. pdb contains 3jvi's coordinates superimposed onto 1phr according to Information window contains the name, PDB , and UniProt number of the clicked amino acid Sequence variants that could not be mapped to the protein structure are listed |
| 166 | 3tmg | - | http://rave.ohiolink.edu/etdc/view?acc_num=miami158754951585964 | Examination and reconstitution of the glycine betaine-dependent methanogenesis pathway from the obligate methylotrophic methanogen Methanolobus vulcani B1d | 2020 | AJ Creighbaum - 2020 - rave.ohiolink.edu | 18 Active site predictions of DhMtgB and MV8460 76 19 Predicted structural model of MV10350 compared to 78 (Hagemeier et al., 2006). No further crystal structure evidence is available to understand the mechanism of demethylation by MtsA or the enzymes responsible for |
| 167 | 5t8s | - | https://bmcpharmacoltoxicol.biomedcentral.com/articles/10.1186/s40360-020-00402-... | Prospects of Indole derivatives as methyl transfer inhibitors: antimicrobial resistance managers | 2020 | S Tha, S Shakya, R Malla- BMC, 2020 - bmcpharmacoltoxicol.biomedcentral | An integration of structure -based virtual screening and ligand-based virtual screening was employed to explore the antimicrobial properties of indole The X-ray diffraction structures of S-adenosyl methionine synthase, MetK from N. gonorrhoeae ( PDB id: 5T8S ) [13]; cobA from |
| 168 | 6vxx | 6vyb | https://www.ncbi.nlm.nih.gov/pmc/articles/pmc7337389/ | Glycans on the SARS-CoV-2 spike control the receptor binding domain conformation | 2020 | R Henderson, RJ Edwards, K Mansouri, K Janowska- bioRxiv, 2020 - ncbi.nlm.nih.gov | this map yielding a structure aligning to the unmutated 2P structure ( PDB ID 6VXX ) with a one RBD 'up' state structure fit to this map to its unmutated counterpart ( PDB ID 6VYB N234A mutation (Figure 3E and andF).F). However, the limited resolution of this structure limits close |
| 169 | 2mu0 | 2kok | https://pubs.acs.org/doi/abs/10.1021/acs.biochem.0c00651 | Isofunctional Clustering and Conformational Analysis of the Arsenate Reductase Superfamily Reveals Nine Distinct Clusters | 2020 | MR Rosen, JB Leuthaeuser, CA Parish, JS Fetrow- Biochemistry, 2020 - ACS Publications | Arsenate reductase (ArsC) is a superfamily of enzymes that reduce arsenate. Due to active site similarities, some ArsC can function as low-molecular weight protein tyrosine phosphatases (LMW-PTPs).... We performed MD simulations to better understand the conformational behavior of each of the nine classes of proteins identified by autoMISST. Starting structures for these simulations were obtained from the following data available in the RCSB PDB:34 group 3AAA, 2KOK (chain A); group 4AA, 2MU0 (chain A); gro |
| 170 | 3jst | - | https://www.sciencedirect.com/science/article/pii/S0141813020335261 | Role of tetrachloro-1, 4-benzoquinone reductase in phenylalanine hydroxylation system and pentachlorophenol degradation in Bacillus cereus AOA-CPS1 | 2020 | OA Aregbesola, A Kumar, MP Mokoena- International Journal of, 2020 - Elsevier | Three-dimensional structure and homology modelling of the protein were predicted by submitting the amino acid sequence at the SWISS-MODEL tool at The modelled PDB files were submitted to an online tool (PDBsum) for determining the structural summary [34]. 2.12 ... and sequence identity of 59%, followed by PCD/DCoH (PDB: 3JST) from Brucella melitensis, |
| 171 | 3vab | - | https://www.biorxiv.org/content/10.1101/2020.10.01.322594v1.full-text | The Phaeodactylum tricornutum Diaminopimelate Decarboxylase was Acquired via Horizontal Gene Transfer from Bacteria and Displays Substrate | 2020 | VA Bielinski, JK Brunson, A Ghosh, MA Moosburner- bioRxiv, 2020 - biorxiv.org | in the active site. The structure underscores features unique to the PtLYSA clan of DAPDC and provides structural insight into the determinants responsible for the substrate-promiscuity observed in PtLYSA. ... Akin to protomer 2 of PtLYSA, this segment is not included in the structures of DAPDC from Aquifex aeolicus (PDB 2P3E) and Brucella melitensis (PDB 3VAB). |
| 172 | 6q04 | - | https://www.sciencedirect.com/science/article/pii/S0079610720301103 | Human coronavirus spike protein-host receptor recognition | 2020 | L Guruprasad- Progress in biophysics and molecular biology, 2020 - Elsevier | cause infection. In this review, we discuss structural features of HCoV spike proteins and recognition of host proteins and carbohydrate receptors. Keywords. Human coronavirus. SARS-CoV. SARS-CoV-2. MERS-CoV. HCoV-HKU1. |
| 173 | 5dvw | - | https://core.ac.uk/download/pdf/323470394.pdf | Napovedni modeli za identifikacijo potencialnih inhibitorjev razlinih proteinov virusa ebole | 2020 | V Hudi - 2020 - core.ac.uk | Monte Carlo MLR Multivariatna linearna regresija mRNA Informacijska ribonukleinska kislina NP Nukleoprotein PCA Metoda glavnih komponent PDB Podatkovna knjinica Knowledge of the viral structure gives us insight into the functioning of the virus and allows us to predict |
| 174 | 3r8c | 3r20, 4die | https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0233689 | The crystal structures of Thermus thermophilus CMP kinase complexed with a phosphoryl group acceptor and donor | 2020 | R Mega, N Nakagawa, S Kuramitsu, R Masui- PloS one, 2020 - journals.plos.org | open form, CMP-bound closed form, ADP-CDP-Gd 3+ -, and CDP-bound forms at resolutions of 1.7, 2.2, 1.5, 1.6, and 1.7 , respectively (Table 1, Fig 1). Structural differences between (B) Superimposition of the overall structure of ligand-free form (gray; PDB code 3W90 ... and ligand-free form of CMPK from M. abscessus (dark gray; 3R8C). These structures were structurally aligned ... The ligand-free form of M. smegmatis CMPK (PDB code 3R20) is almost the same structure as M. abscessus CMPK. |
| 175 | 6q05 | - | https://www.biorxiv.org/content/10.1101/2020.04.17.047548v1.abstract | Distinct structural flexibility within SARS-CoV-2 spike protein reveals potential therapeutic targets | 2020 | SH Chen, MT Young, J Gounley, C Stanley, D Bhowmik- BioRxiv, 2020 - biorxiv.org | of SARS-CoV-2 ( PDB 6VSB [3]), SARS-CoV-1 ( PDB 6CRZ [15]), MERS- CoV ( PDB 6Q05 [16]), and The trimeric state of the SARS-CoV-2 S protein consists of all three chains in PDB 6VSB Each structure was solvated in the center of a water box with a minimum distance of 15 A |
| 176 | 4dz4 | - | https://www.frontiersin.org/articles/10.3389/fpls.2020.00987/full?report=reader | The neighboring subunit is engaged to stabilize the substrate in the active site of plant arginases | 2020 | B Sekula- Frontiers in plant science, 2020 - frontiersin.org | It is worth noting that the structure of agmatinase from Deinococcus radiodurans ( PDB ID: 1WOG) (Ahn et al., 2004) is ID: 3LHL), agmatinase from Thermoplasma volcanium (TvAGM, PDB ID: 3PZL), and agmatinase from Burkholderia thailandensis (BtAGM, PDB ID: 4DZ4 ) |
| 177 | 5ez3 | - | https://f1000research.com/articles/9-1268 | Characterization of sulfated polysaccharide activity against virulent Plasmodium falciparum PHISTb/RLP1 protein | 2020 | JM Mutisya, VA Mobegi, JK Kinyua, MN Kivecu- , 2020 - f1000research.com | sequences to the reference, 12 non-synonymous single nucleotide polymorphisms were considered for mutant protein structure analysis. Eleven drug compounds with antiplasmodial activity were identified. Both modelled PHISTb/RLP1 reference and mutant structures had a |
| 178 | 6q04 | - | https://www.tandfonline.com/doi/abs/10.1080/14760584.2020.1813574 | An overview of Middle East respiratory syndrome coronavirus vaccines in preclinical studies | 2020 | N Zhang, J Shang, C Li, K Zhou, L Du- Expert Review of Vaccines, 2020 - Taylor & Francis | Structures of MERS-CoV S1-NTD and MERS-CoV S1-NTD-Neu5Ac complex are presented by ribbon model ( PDB code 6Q04 ) (A) Structure of MERS Both MERS-CoV macro domain and ADP-ribose are presented by ribbon model in green and red, separately ( PDB code 5DUS |
| 179 | 6nb6 | - | https://www.sciencedirect.com/science/article/pii/S0092867420307571 | Structures of human antibodies bound to SARS-CoV-2 spike reveal common epitopes and recurrent features of antibodies | 2020 | CO Barnes, AP West Jr, KE Huey-Tubman- Cell, 2020 - Elsevier | Share. Export. Advanced. Cell Cell. Volume 182, Issue 4, 20 August 2020, Pages 828-842.e16. Journal home page for Cell. Article. Structures of Human Antibodies Bound to SARS-CoV-2 Spike Reveal Common Epitopes and Recurrent Features of Antibodies |
| 180 | 2lwk | - | https://www.frontiersin.org/articles/10.3389/fchem.2020.00107/full?utm_source=S-... | Exploring the RNA-Recognition Mechanism Using Supervised Molecular Dynamics (SuMD) Simulations: Toward a Rational Design for Ribonucleic-Targeting | 2020 | M Bissaro, M Sturlese, S Moro- Frontiers in Chemistry, 2020 - frontiersin.org | (B) Superimposition between the experimental NMR complex ( PDB ID 2LWK , green-colored DPQ (D) RMSD of RNA phosphate atoms belonging to the backbone, computed against the PDB reference. (E) Flexibility characterizing the RNA structure during DPQ binding event |
| 181 | 6bfu | - | https://www.biorxiv.org/content/10.1101/2020.02.18.955195v1.abstract | Structure and immune recognition of the porcine epidemic diarrhea virus spike protein | 2020 | RN Kirchdoerfer, M Bhandari, O Martini, LM Sewall- bioRxiv, 2020 - biorxiv.org | from HuCoV-NL63 (5SZS. pdb (Walls et al., 2016b)), Porcine deltacoronavirus ( 6BFU . pdb , (Xiong et pdb , (Kirchdoerfer et al., 2018)) and Infectious bronchitis virus (6CV0. pdb , (Shang et the PEDV spike differs in several regards to the previously determined NL63 spike structure |
| 182 | 5tw7 | - | https://www.biorxiv.org/content/10.1101/808618v2.full-text | Helices on interdomain interface couple catalysis in the ATPPase domain with allostery in Plasmodium falciparum GMP synthetase | 2020 | S Shivakumaraswamy, N Pandey, L Ballut, S Violot- bioRxiv, 2020 - biorxiv.org | Experimental Procedures. Sequence and structure analysis The PDB IDs of the structures of GMPS analyzed are 1GPM (Escherichia coli), 3TQI (Coxiella burnetii), 2YWB and 2YWC (Thermus thermophilus), 5TW7 (Neisseria gonorrhoeae), 2VXO (Homo sapiens), 3UOW |
| 183 | 4y0e | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/ange.201914896 | Pathway from Nalkylglycine to alkylisonitrile catalyzed by iron (II) and 2oxoglutarate dependent oxygenases | 2020 | WC Chang, TY Chen, J Chen, Y Tang- Angewandte, 2020 - Wiley Online Library | Table S4). Dali search suggested the structure of ScoE resembles those of other Fe/2OG-enzymes such as CarC ( PDB ID: 4oj8) and a putative dioxygenases ( PDB ID: 4y0e ), with Z-score of 20.0 and 26.7, respectively. In the |
| 184 | 3s6l | - | https://www.frontiersin.org/articles/10.3389/fbioe.2020.613986/pdf | Modelled structure of the cell envelope proteinase of Lactococcus lactis | 2020 | EB Hansen, P Marcatili- Frontiers in bioengineering and, 2020 - frontiersin.org | The architecture of the L. lactis CEP shares features with a large number of serine proteases to use current state of the art structure prediction algorithms to establish a structural model of software (version 2.3.3)2 was used for visualization and editing of protein structure PDB files |
| 185 | 4k9d | - | https://www.ingentaconnect.com/contentone/ben/cdth/2020/00000015/00000003/art000... | Network-Pharmacology and DFT Based Approach Towards Identification of Leads from Homalomena aromatica for Multi-Target In-Silico Screening on Entamoeba | 2020 | AK Goswami, HK Sharma, N Gogoi- Current Drug, 2020 - ingentaconnect.com | The 3D model of EhGAPDH was predicted based on multiple templates ( PDB IDs: 4O59, 4K9D , 1U8F, 4Z0H, 3V1Y) It uses robust, cross-validated Quantitative Structure Toxicity Relationship (QSTR) models for assessing various measures of toxicity. 3.6 |
| 186 | 6q04 | 6VXX | https://www.mdpi.com/1999-4915/12/9/909 | The sialoside-binding pocket of SARS-CoV-2 spike glycoprotein structurally resembles MERS-CoV | 2020 | M Awasthi, S Gulati, DP Sarkar, S Tiwari, S Kateriya- Viruses, 2020 - mdpi.com | Multiple sequence alignment of the NTD domains was performed with the Clustal W program [15]. 2.2. Structure Prediction. The cryo-EM structures of SARS-CoV-2 ( PDB ID: 6VXX) [8] and MERS-CoV ( PDB ID: 6Q04 ) [11] spike glycoproteins were used as the starting point for |
| 187 | 4ol9 | 4qji | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7770189/ | Vitamin in the Crosshairs: Targeting Pantothenate and Coenzyme A Biosynthesis for New Antituberculosis Agents | 2020 | HS Butman, TJ Kotz, CS Dowd- Frontiers in Cellular and, 2020 - ncbi.nlm.nih.gov | This review gathers literature reports on the structure /mechanism, inhibitors, and vulnerability of each enzyme in the CoA pathway... To date, there is very little information available for the Mtb PanE homologue (MtPanE). The activity of the protein expressed by the putative panE gene (Rv2573) has not been experimentally verified, although its crystal structure bound to NADP+ and oxamate has been solved (PDB ID: 4OL9). |
| 188 | 6uk3 | 5v96, 6aph, 3d64, 3n58, 3glq | https://www.mdpi.com/2218-273X/10/12/1682 | S-adenosyl-l-homocysteine Hydrolase: A Structural Perspective on the Enzyme with Two Rossmann-Fold Domains | 2020 | K Brzezinski- Biomolecules, 2020 - mdpi.com | major [3G1U, unpublished], Cryptosporidium parvum [5HM8 unpublished], Acanthamoeba castellanii [ 6UK3 , unpublished], Naegleria Crystal structures of SAHases were acquired from PDB cofactor-binding domains was performed based on secondary structure assignments in |
| 189 | 3u04 | - | https://books.google.com/books?hl=en&lr=&id=odPbDwAAQBAJ&oi=fnd&pg=PP1&dq=%223U0... | Drug Repurposing in Cancer Therapy: Approaches and Applications | 2020 | KKW To, WCS Cho - 2020 - books.google.com | Page 1. Drug RE pu irposir g in Approaches and Applications Edited by Kenneth K. W. To William CS Cho MEDIA BUSINESS WORLD TUORK $60CM WORLD so OH HC E ENT N-Cro C CI AP CH3 Page 2. DRUG REPURPOSING IN CANCER THERAPY Page 3 |
| 190 | 5v6d | 4dut, 6ay1, 4ek2, 4hr2 | https://www.mdpi.com/1422-0067/21/18/6779 | Structure, Folding and Stability of Nucleoside Diphosphate Kinases | 2020 | F Georgescauld, Y Song, A Dautant- International Journal of Molecular, 2020 - mdpi.com | So far, 162 structures from 30 different species have been deposited within the Protein Data Bank ( PDB ) which fall to tetramer type II and two are isolated dimers [23,24,25] (Table 1). The structure of most tetramers was recently solved by a structural genomics approach yet ... 5v6d Neisseria gonorrhoeae in complex with citrate (1.85 Å) Abendroth, J.; Mayclin, S.J.; Lorimer, D.D.; Edwards, T.E. |
| 191 | 4ni5 | 4weo, 5jy1 | https://biotechnologyforbiofuels.biomedcentral.com/articles/10.1186/s13068-020-0... | Phylogenetics-based identification and characterization of a superior 2, 3-butanediol dehydrogenase for Zymomonas mobilis expression | 2020 | V Subramanian, VV Lunin- Biotechnology, 2020 - biotechnologyforbiofuels | Zymomonas mobilis has recently been shown to be capable of producing the valuable platform biochemical, 2,3-butanediol (2,3-BDO). Despite this capability, the production of high titers of 2,3-BDO is restricted by several physiological parameters. ... The initial model was built based on PDB entry 4ni5 with FFAS03 search and ProtMod modeling servers [50,51,52] using the SCWRL method. |
| 192 | 6q04 | 6VXX | https://www.researchsquare.com/article/rs-37300/latest.pdf | N-terminal domain (NTD) of SARS-CoV-2 spike-protein structurally resembles MERS-CoV NTD sialoside-binding pocket | 2020 | M Awasthi, S Gulati, DP Sarkar, S Tiwari, S Kateriya - 2020 - researchsquare.com | W program [14]. Structure preparation The cryo-EM structures of SARS-CoV-2 ( PDB ID: 6VXX) [8] and MERS-CoV ( PDB ID: 6Q04 ) [10] spike spike glycoprotein (YP_009724390. 1) was strongly biased on the crystal structure of SARS-CoV-2, while |
| 193 | 6nb3 | 6nb7, 6nb4, 6nb6, 6vyb, 6vxx | https://link.springer.com/article/10.1007/s00018-020-03580-1 | Protein structure analysis of the interactions between SARS-CoV-2 spike protein and the human ACE2 receptor: from conformational changes to novel | 2020 | I Mercurio, V Tragni, F Busto, A De Grassi- Cellular and Molecular, 2020 - Springer | Download PDF. Download PDF. Original Article; Published: 04 July 2020. Protein structure analysis of the interactions between SARS-CoV-2 spike protein and the human ACE2 receptor: from conformational changes to novel neutralizing antibodies |
| 194 | 6bfu | 6q04, 6nb3, 6q05, 6q07, 6nb4, 6nb7, 6q06 | https://www.biorxiv.org/content/10.1101/2020.07.16.207308v3.abstract | Systematic modeling of SARS-CoV-2 protein structures | 2020 | SI O'Donoghue, A Schafferhans, N Sikta, C Stolte- bioRxiv, 2020 - biorxiv.org | CoV, 82% identity, E = 10-24) with a fold not seen in any other PDB structure (CATH 3.40 from SARS-CoV-2, 98% identity, E = 10-44), all with beta barrel architecture (CATH 2.40 6acg from SARS-CoV, 77% identity, E = 10-321), of which one structure also showed |
| 195 | 5cy4 | - | https://munin.uit.no/handle/10037/17279 | A functional and structural study of three bacterial nucleic acid-interacting proteins. The story of a Ferric Uptake Regulator, an Oligoribonuclease and an ATP | 2020 | K Berg - 2020 - munin.uit.no | Acinetobacter baumannii (PDB 5CY4) and E. coli (PDB code 1YTA )[148]. All Orn homologs are structurally similar and topologically arranged |
| 196 | 5i1f | 5j49, 5vct, 5ve7 | https://www.frontiersin.org/articles/10.3389/fmicb.2020.01596/full?report=reader | In vitro and in vivo Evaluation of in silico Predicted Pneumococcal UDPG: PP Inhibitors | 2020 | F Cools, D Triki, N Geerts, P Delputte- Frontiers in, 2020 - frontiersin.org | Currently, the crystal structure of UDPG:PP is only known for several eukaryotes and following bacteria: Helicobacter pylori ( PDB codes 3JUJ and 3JUK) (Kim et al., 2010), E. coli ( PDB code 2E3D) (Thoden and Holden ( PDB codes 5VCT, 5VE7, 5J49, 5I1F ) (Abendroth et al |
| 197 | 5vnx | 3qhx | https://www.sciencedirect.com/science/article/pii/S0022283620306033 | Crystallographic Snapshots of the Dunathan and Quinonoid Intermediates provide Insights into the Reaction Mechanism of Group II Decarboxylases | 2020 | SC Gayathri, N Manoj- Journal of Molecular Biology, 2020 - Elsevier | Previously, we reported the biochemical characterization and the crystal structure of an archaeal type-I transferase superfamily and displays the characteristic three-domain architecture of the PLP aldehyde bound form (apoMjDCPLP ALD , non-covalently bound, PDB ID: 3F9T |
| 198 | 3hhe | 3uw1 | https://www.sciencedirect.com/science/article/pii/S0141022920300971 | Biochemical and structural insights into an Ochrobactrum sp. CSL1 ribose-5-phosphate isomerase A and its roles in isomerization of rare sugars | 2020 | X Ju, X Xu, M Shen, X Mo, H Fan, L Liangzhi- Enzyme and Microbial, 2020 - Elsevier | thermophilus (TtRpiA, 1UJ5), Burkholderia thailandensis (BtRpiA, 3UW1), Bartonella henselae (BhRpiA, 3HHE ) and E. coli (EcRpiA, 1O8B) with ligand-binding structures in PDB , the sequence Homology modeling is an option to investigate the structure -activity relationship of |
| 199 | 5td3 | 5vxt, 5umh | https://www.frontiersin.org/articles/10.3389/fmicb.2020.01100/full | Characterization of a Novel Functional Trimeric Catechol 1, 2-Dioxygenase From a Pseudomonas stutzeri Isolated From the Gulf of Mexico | 2020 | J Rodrguez-Salazar, AG Almeida-Juarez- Frontiers in, 2020 - frontiersin.org | substrates in its catalytic site (Vetting and Ohlendorf, 2000; Earhart et al., 2005; Micalella et al., 2011, PDB entries: 2XSR 5UMH, 5TD3 , and 5VXT) model of PSC12DO was elaborated using the CPHmodels 3.2 Server based on the C12DO P. arvilla structure (PDBid: 2AZQ ... Burkholderia vietnamiensis, 48% (PDBid:5TD3); and Burkholderia ambifaria, 43% (PDBid:5VXT). The most variable regions are located in residues 1–29 |
| 200 | 3hgb | - | https://www.frontiersin.org/articles/10.3389/fbioe.2020.00965/full?report=reader | Mechanism-driven metabolic engineering for bio-based production of free R-lipoic acid in Saccharomyces cerevisiae mitochondria | 2020 | B Chen, JL Foo, H Ling, MW Chang- Frontiers in bioengineering and, 2020 - frontiersin.org | is glycine cleavage system protein H from Mycobacterium tuberculosis ( PDB chain id: 3hgb .1.A domains) were modeled due to the lack of templates with crystal structure of full acetyltransferase component of the pyruvate dehydrogenase complex in Homo sapiens ( PDB |
| 201 | 6nb6 | 6nb7 | https://www.nature.com/articles/s41598-020-74715-4 | Molecular docking study of potential phytochemicals and their effects on the complex of SARS-CoV2 spike protein and human ACE2 | 2020 | A Basu, A Sarkar, U Maulik- Scientific reports, 2020 - nature.com | Every coronavirus comprises four structural proteins namely spike, envelope, nucleocapsid and membrane proteins Similarly, PDB ID 6M17 shows the presence of sodium-dependent neutral amino acid transporter B(O)AT1 in its structure |
| 202 | 6c87 | 6byq, 6nab, 6dbb | https://search.proquest.com/openview/cd4a41694b18b16f6cb97e7640174525/1?pq-origs... | Exploring Unconventional Approaches to Molecular Replacement in X-ray Crystallography with SIMBAD | 2020 | AJ Simpkin - 2020 - search.proquest.com | to finding search models for MR is to use the sequence of the target structure to identify a approach is based on the assumption that sequence similarity is a useful guide to structural similarity final step is a brute-force search of a non-redundant derivative of the PDB provided by |
| 203 | 4g6c | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7744477/ | New Putative Antimicrobial Candidates: In silico Design of Fish-Derived Antibacterial Peptide-Motifs | 2020 | H Okella, JJ Georrge, S Ochwo, C Ndekezi- Frontiers in, 2020 - ncbi.nlm.nih.gov | a global docking procedure in four folds, motif-based prediction based on peptide conformation, rigid-body docking, scoring based on structural clustering; and final structure minimization. ... The affinity of peptide-motifs A15_B and A15_E was highest within chains of the target proteins (PDB ID 1rrv, 4g6c, and 4oj8). |
| 204 | 5b8i | - | http://www.plantphysiol.org/content/182/2/1142?utm_source=TrendMD&utm_medium=cpc... | Two SnRK2-interacting calcium sensor isoforms negatively regulate SnRK2 activity by different mechanisms | 2020 | K Tarnowski, M Klimecka, A Ciesielski, G Goch- Plant, 2020 - Am Soc Plant Biol | Skip to main content |
| 205 | 3u0g | - | https://link.springer.com/article/10.1007/s00253-020-10369-6 | Structural insight into the substrate specificity of PLP fold type IV transaminases | 2020 | EY Bezsudnova, VO Popov, KM Boyko- Applied Microbiology and, 2020 - Springer | Due to the rigid structure of the -sheet, the residues constituting it form a peculiar mold for substrate binding. The interdomain loop (light blue) and -turn (black) of the large domain of the first subunit confine the P-pocket from the other sides PDB ID:*. X-strand 3U0G |
| 206 | 3p0x | - | https://www.sciencedirect.com/science/article/pii/S0166685120300992 | Characterisation and structural analysis of glyoxylate cycle enzymes of Teladorsagia circumcincta | 2020 | S Umair, C Bouchet, N Palevich, HV Simpson- Molecular and Biochemical, 2020 - Elsevier | to compare the TciICL and TciMS protein sequences with deposited structures in the Protein Data Bank ( PDB ) Locations are shown of the C- and N-terminus in the predicted tertiary structure of TciICL C) and TciMS in salmon (F) within 4 of the superimposed 3P0X and 3S9Z |
| 207 | 3obk | - | https://www.sciencedirect.com/science/article/pii/S2468111320300372 | The Se S/N interactions as a possible mechanism of -aminolevulinic acid dehydratase enzyme inhibition by organoselenium compounds: a computational study | 2020 | PA Nogara, L Orian, JBT Rocha- Computational Toxicology, 2020 - Elsevier | Figure 1. (A) The structural formula of some organoselenium compounds, (B) the 5-aminolevulinic acid (5 theory (DFT) approach, are frequently used in the study of structures , reactions, and modeling has been successfully employed to predict the 3D protein structure , which is... (HEM2_STAAR); Toxoplasma gondii: PDB (3OBK); Wolbachia: NCBI (WP_041571452.1). |
| 208 | 3lr0 | - | https://arxiv.org/abs/2009.07466 | The role of hydrophobic interactions in folding of -sheets | 2020 | J Li, X Ma, H Zhang, C Hou, L Shi, S Guo- arXiv preprint arXiv, 2020 - arxiv.org | Nature Structural Biology 10, 980, doi:10.1038/nsb1203-980 (2003). 19 Berman, H., Henrick, K., Nakamura, H. & Markley, JL The worldwide Protein Data Bank (wwPDB): ensuring a single, uniform archive of PDB data Structure relaxation via long trajectories made stable |
| 209 | 3qh4 | - | https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0226838 | Crystal structure of PMGL2 esterase from the hormone-sensitive lipase family with GCSAG motif around the catalytic serine | 2020 | KM Boyko, MV Kryukova, LE Petrovskaya- PloS one, 2020 - journals.plos.org | mPMGL2 demonstrated no structural or biochemical differences compared to the wild type enzyme, but with the atomic coordinates of the esterase EstE5 from uncultured bacterium ( PDB ID: 3L1H The wtPMGL2 structure was then used to solve mPMGL2 at 1.43 resolution... Besides the above mentioned enzymes, the only known structure of an enzyme from the GTSAG subfamily of bHSL is an esterase LipW from Mycobacterium marinum (PDB ID 3QH4), whose proposed dimer also shares the same structural feature |
| 210 | 2lwk | - | https://chemrxiv.org/ndownloader/files/25634519 | DrugPred_RNAStructure-based druggability predictions for RNA binding sites | 2020 | IH Rekand, R Brenk - 2020 - chemrxiv.org | However, the structure of the complex has been determined by NMR and it is possible that the resolution of the structure is not accurate enough to reveal the actual details of the binding mode.51 The Spinach Figure 6: Binder of influenza A promoter region ( PDB ID 2lwk ) |
| 211 | 4g7f | - | http://www.academiajournals.com/s/6-Tesis-Gutierrez-Soto-Montserrat.pdf | HUMANIDADES, CIENCIA, TECNOLOGA E INNOVACIN EN PUEBLA | 2020 | MG SOTO, C SUBCUTNEA - academiajournals.com | Agarosa NTD Enfermedades Tropicales Desatendidas OMS Organizacin Mundial de la Salud ONU Organizacin de las Naciones Unidas OPS Organizacin Panamericana de la Salud PBS Buffer salino de fosfatos PBS-T Buffer salino de fosfatos-Tween 20 PDB Banco de |
| 212 | 4odj | - | https://pubs.rsc.org/en/content/articlehtml/2019/cc/c9cc07807j | Nucleoside-modified AdoMet analogues for differential methyltransferase targeting | 2020 | NV Cornelissen, F Michailidou, F Muttach- Chemical, 2020 - pubs.rsc.org | 39 In addition, we tested the putative wildtype MAT from Cryptosporidium hominis (ChMAT) that had been crystallized by the Seattle Structural Genomics Center for Infectious Disease (SSGCID) but was otherwise ChMAT ( PDB : 4ODJ ) and hMAT2a ( PDB : 5A1G) have 59 |
| 213 | 6ao8 | - | https://aac.asm.org/content/64/6/e02252-19.abstract | Mutations in ArgS Arginine-tRNA Synthetase Confer Additional Antibiotic Tolerance Protection to Extended-Spectrum--Lactamase-Producing Burkholderia | 2020 | H Yi, J Park, KH Cho, HS Kim- Antimicrobial Agents and, 2020 - Am Soc Microbiol | To investigate the ArgS function affected by the mutations, we first computationally predicted the B. thailandensis ArgS structure by using the homologous structure of Neisseria gonorrhoeae (PDB accession no. 6AO8) using Modeller |
| 214 | 3p96 | - | https://www.sciencedirect.com/science/article/pii/S0006291X20314042 | Biochemical characterization of phosphoserine phosphatase SerB2 from Mycobacterium marinum | 2020 | E Pierson, J Wouters- Biochemical and Biophysical Research, 2020 - Elsevier | MmaSerB2 and MtbSerB2 are similar in their catalytic behaviour and architecture . Fig. 2. A) Structure of MmaSerB2 modeled by homology on the basis of M. avium SerB structure ( PDB 3P96 ). The individual domains are labelled. Active site residues are shown in red |
| 215 | 4yl5 | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7093009/ | Essential Metabolic Routes as a Way to ESKAPE from Antibiotic Resistance | 2020 | ALC Barra, CD Lvia de Oliveira, LG Moro- Frontiers in Public, 2020 - ncbi.nlm.nih.gov | ID 2I5B (23)], Thermus thermophilus ( PDB ID 1UB0), A. baumannii ( PDB ID 4YL5 ), Bacteroides thetaiotaomicron tuberculosis (3O63), and for the bifunctional enzyme from Candida glabrata [ PDB IDs 3NL2 No crystal structure of an ESKAPE pathogen, ThiE, is available to date |
| 216 | 6wps | - | https://www.ncbi.nlm.nih.gov/pmc/articles/pmc7457611/ | Structural classification of neutralizing antibodies against the SARS-CoV-2 spike receptor-binding domain suggests vaccine and therapeutic strategies | 2020 | CO Barnes, CA Jette, ME Abernathy, KMA Dam- bioRxiv, 2020 - ncbi.nlm.nih.gov | 1g) that were isolated from the same donor 5 . They share structural similarities with each other and with other VH353/short 1) and C144 Fab (from C144-S structure ) aligned on a RBD monomer. ACE2 ( PDB 6M0J; light green surface) is aligned on the same RBD for reference ... Composite model of C135-RBD (blue and gray, respectively) overlaid with the SARS-CoV-2 NAb S309 (sand, PDB 6WPS) and soluble ACE2 |
| 217 | 5ts2 | 3pxu | https://www.sciencedirect.com/science/article/pii/S1570963920302132 | Phosphopantetheine Adenylyltransferase: A promising drug target to combat antibiotic resistance | 2020 | A Gupta, P Sharma, TP Singh, S Sharma- Biochimica et Biophysica Acta, 2020 - Elsevier | Although, the DPCK domain of the human fusion protein shows high sequence and structural homology to bacterial DPCK The PDB IDs of the structure , percentage sequence identities and rms deviations for the C atoms are also indicated ... The structures of complexes of PPAT with dPCoA from several bacterial species have been determined so far and include EcPPAT (PDB ID: 1B6T), MtPPAT (PDB ID: 3RBA), BpPPAT (PDB ID: 3PXU), MaPPAT (PDB ID: 5O08), PaPPAT (PDB ID: 5TS2) and AbPPAT (PDB ID: 5ZZC |
| 218 | 5VOG | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7674647/ | Structural analysis of (p) ppGpp reveals its versatile binding pattern for diverse types of target proteins | 2020 | GS Kushwaha, A Patra, NS Bhavesh- Frontiers in microbiology, 2020 - ncbi.nlm.nih.gov | Although, glycosidic bond and ribose sugar in the nucleotide structure exhibit conformational flexibility and classical molecular dynamics simulation on nucleotides is S.No, Macromolecule Name, Resolution (), PDB ID 14, Putative phosphoribosyltransferase, 1.50, 5VOG |
| 219 | 3ixc | - | https://www.frontiersin.org/articles/10.3389/fmicb.2020.00742/full?report=reader | Crystal structure and active site engineering of a halophilic -carbonic anhydrase | 2020 | M Vogler, R Karan, D Renn, A Vancea- Frontiers in, 2020 - frontiersin.org | (C) The surface potential of CA_D compared to mesophilic -CA homologs (Escherichia coli, 3tio; Salmonella enterica, 3r3r; Anaplasma phagocytophilum, 3ixc ; Bacillus cereus, 1xhd (A) CA_D (crystal structure ), (B) Cam (crystal structure ) from M. thermophila ( PDB ID: 1qrg |
| 220 | 3gbz | - | https://pubs.rsc.org/--/content/articlehtml/2020/me/c9me00097f | How does evolution design functional free energy landscapes of proteins? A case study on the emergence of regulation in the Cyclin Dependent Kinase family | 2020 | Z Shamsi, D Shukla- Molecular Systems Design & Engineering, 2020 - pubs.rsc.org | PDB ID: 5OSM, 6Q3F, 6Q4A, 6Q4B, 6Q4C, 6Q4D, 6Q4K), G/CDK ( PDB ID: 3GBZ ), and pfpk5 on the GA341 score and have comparable DOPE scores with the CDK2 native structure as shown Template's PDB ID, DOPE score for CMGI, DOPE score for native CDK2, GA341 score |
| 221 | 3u0g | - | https://www.mdpi.com/2073-4344/10/9/1024 | Counterbalance of Stability and Activity Observed for Thermostable Transaminase from Thermobaculum terrenum in the Presence of Organic Solvents | 2020 | EY Bezsudnova, AY Nikolaeva, SY Kleymenov- Catalysts, 2020 - mdpi.com | the hydration shell and the interface of the enzyme molecules, thus defining the balance between the structural integrity and Somewhat counterintuitively, crystallographic studies of solvent-resistant enzymes did not reveal significant changes in structures obtained from crystals |
| 222 | 3rr6 | 3qdf, 4pfz, 4maq | https://sfamjournals.onlinelibrary.wiley.com/doi/abs/10.1111/1462-2920.14844 | Sequence, structure and functionbased classification of the broadly conserved FAH superfamily reveals two distinct fumarylpyruvate hydrolase subfamilies | 2020 | H Hong, H Seo, W Park, KJ Kim- Environmental microbiology, 2020 - Wiley Online Library | This article is protected by copyright. All rights reserved. Page 24. uncharacterized protein from M. abscessus DSM 44196 ( PDB code 3RR6 , 36 % sequence identity) as a search model. The structure model was built using the WinCoot program (Emsley |
| 223 | 3tcq | - | https://www.biorxiv.org/content/10.1101/2020.05.27.108969v1.abstract | Common substructures and sequence characteristics of sandwich-like proteins from 42 different folds | 2020 | A Kister- BioRxiv, 2020 - biorxiv.org | structural classification in PDBSum database30 does not support sandwich-like architecture was examined. For secondary structure analysis, the information about localization of strands in sequences was taken from PDB .31 For supersecondary structure (SSS) of the domains |
| 224 | 6q05 | - | https://arxiv.org/abs/2002.06196 | Structural modeling of 2019-novel coronavirus (nCoV) spike protein reveals a proteolytically-sensitive activation loop as a distinguishing feature compared to SARS | 2020 | JA Jaimes, NM Andre, JK Millet- arXiv preprint arXiv, 2020 - arxiv.org | Protein Data Base: HCoV-HKU1 ( PDB # 5I08), MHV ( PDB # 3JCL), MERS-CoV ( PDB # 6Q05 ), SARS-CoV ( PDB # 5X58), FCoV-UU4 ( PDB # 6JX7), IBV-M41 ( PDB # 6CV0) and HCoV-NL63 ( PDB # 5SZS). Pairwise S structure . Additional |
| 225 | 2kn9 | - | https://www.biorxiv.org/content/10.1101/2020.10.27.356691v1.abstract | A new twist of rubredoxin function in M. tuberculosis | 2020 | T Sushko, A Kavaleuski, I Grabovec, A Kavaleuskaya- bioRxiv, 2020 - biorxiv.org | 21]. Previously, a zinc-substituted RubB structure was solved by NMR ( PDB ID: 2KN9 ). Pairwise . In the NMR model, residues at C and N termini show backbone variability, while the rest of the structure remain almost unperturbed |
| 226 | 3s6d | - | https://www.biorxiv.org/content/10.1101/2020.12.04.412312v2.abstract | Leptospira interrogans triosephosphate isomerase: exploring the structural determinants of stability, high reaction rate and specificity. | 2020 | V Pareek, V Dhayabarn, H Balaram, PR Krishnaswamy- bioRxiv, 2020 - biorxiv.org | Contrary to our observation for the LiTIM structure , the backbone -CO of Trp11 has previously been observed in other TIMs (eg Page 15. 15 rare example of Glu at position 94 (LiTIM numbering) is in Coccidiodes immitis ( PDB ID: 3S6D ; Figures S2 and S5B) |
| 227 | 6c9e | - | https://www.biorxiv.org/content/10.1101/2020.05.24.113720v1.abstract | Discovery and characterization of a novel family of prokaryotic nanocompartments involved in sulfur metabolism | 2020 | RJ Nichols, B LaFrance, NR Phillips, LM Oltrogge- bioRxiv, 2020 - biorxiv.org | additional density for the holo-SrpI with a 243 homologous cysteine desulfurase dimer docked in ( pdb : 6c9e ) the first Family 2 encapsulin structure and is 267 the highest resolution structure for an Given the structural 271 similarity of the entire shell, it is unsurprising that the SrpI |
| 228 | 5ucm | - | https://www.sciencedirect.com/science/article/pii/S002192581750441X | Human trans-editing enzyme displays tRNA acceptor-stem specificity and relaxed amino acid selectivity | 2020 | O Vargas-Rodriguez, M Bakhtina, D McGowan- Journal of Biological, 2020 - Elsevier | Corrections to the resulting alignment were made based on the structural alignment of Cc ProXp-ala (Protein Data Bank entry 5VXB) and Pa ProRS (Protein Data Bank entry 5UCM). |
| 229 | 6pqh | - | https://orca.cf.ac.uk/138637/1/2021HanadiAsiriPhD.pdf | Development of Novel Antibacterial Agents through the Design and Synthesis of Aminoacyl tRNA Synthetase (AaRS) Inhibitors | 2020 | H Asiri, C Simons, E Mantzourani - 2020 - orca.cf.ac.uk | 33 Figure 16: Chemical structures of LysRS and AspRS inhibitors. 34 Figure 17: Chemical structures of AsnRS and AlaRS inhibitors. 34 Figure 21: 3D structure of Thermus thermophilus AsnRS ( pdb : 5ZG8) with two-8 amino acid residues gaps (161-168 and 209-216) identified. Table 7. Elizabethkingia anopheles 6PQH |
| 230 | 4eqy | - | https://www.mdpi.com/2218-273X/10/2/266 | Structure-Based Virtual Screening of Pseudomonas aeruginosa LpxA Inhibitors Using Pharmacophore-Based Approach | 2020 | BV Bhaskar, TMC Babu, A Rammohan, GY Zheng- Biomolecules, 2020 - mdpi.com | 1J2Z) [22], Leptospira interrogans ( PDB ID: 3HSQ) [23] and Burkholderia thailandensis ( PDB ID: 4EQY ) [24] were In this study, the PaLpxA structure was superimposed on LpxA orthologs from different bacterial Organism PDB ID Monomer A Monomer B RMSD () Pocket Size ( |
| 231 | 6an0 | - | https://www.mdpi.com/2076-2607/8/5/732 | The Role of Gene Elongation in the Evolution of Histidine Biosynthetic Genes | 2020 | S Del Duca, S Chioccioli, A Vassallo, LM Castronovo- Microorganisms, 2020 - mdpi.com | 6AN0 Elizabethkingia anophelis Amino acid sequences from HisA/HisF, IGPD, and HDH, available in the PDB , were downloaded from UniProt [29], aligned using BioEdit [30] through the ClustalW tool [31], and the conservation of the secondary structure organization was |
| 232 | 6bla | - | https://journals.plos.org/plospathogens/article?rev=2&id=10.1371/journal.ppat.10... | Recognition of a highly conserved glycoprotein B epitope by a bivalent antibody neutralizing HCMV at a post-attachment step | 2020 | X Ye, H Su, D Wrapp, DC Freed, F Li, Z Yuan- PLoS, 2020 - journals.plos.org | A 1.8 crystal structure of 325 Fab in complex with the peptide epitope revealed the molecular determinants of 325 binding to gB A molecular replacement solution was found in PHASER [67] by using a search ensemble generated from PDB IDs: 6BLA and 6DDM. |
| 233 | 3p96 | - | https://www.mdpi.com/1420-3049/25/2/415 | Identification and Repurposing of Trisubstituted Harmine Derivatives as Novel Inhibitors of Mycobacterium tuberculosis Phosphoserine Phosphatase | 2020 | E Pierson, M Haufroid, TP Gosain, P Chopra, R Singh- Molecules, 2020 - mdpi.com | SerB2 model generated by homology modeling based on the crystal structure of Mycobacterium avium SerB (Protein Data Bank ( PDB ) entry 3P96 ) is in The docked structure of the best inhibitor, compound 124, is shown in Figure 4. Analysis of those structures shows that |
| 234 | 4odj | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/anie.202012623 | Engineered SAM synthetases for enzymatic generation of AdoMet analogs with photocaging groups and reversible DNA modification in cascade reactions | 2020 | F Michailidou, N Klcker- Angewandte Chemie, 2020 - Wiley Online Library | Figure 3. A) Superimposed structures of WT-ChMAT ( 4ODJ , shown in yellow) with product bound PC-ChMAT (6LTV, shown in grey) and share a sequence identity of 51% and are highly conserved in the active site (Figure S17), and our structure of PC-ChMAT ( PDB ID: 6LTV |
| 235 | 3sdo | - | https://www.biorxiv.org/content/10.1101/2020.08.24.261826v1.abstract | On the diversity of F420-dependent oxidoreductases: a sequence-and structure-based classification | 2020 | ML Mascotti, MJ Ayub, M Fraaije- bioRxiv, 2020 - biorxiv.org | monooxygenase (NTA_MO, PDB : 3sdo ), as well as the well-known bacterial FMN- dependent luciferases (eg.: LuxB, PDB : 1luc) [28]. The topology suggests that cofactor vary considerably in structure and function, and comprise the F420H2-NADP+ oxidoreductases |
| 236 | 3rd5 | - | https://link.springer.com/article/10.1007/s42535-020-00140-7 | In silico structural analysis and ligand-binding predictions of a few developmental stage specific-proteins during in vitro morphogenesis in Vanilla | 2020 | M Sultana, G Gangopadhyay- Vegetos, 2020 - Springer | The crystal structure of anoxidoreductase protein (a putative uncharacterized protein from Mycobacterium paratuberculosis, PDB ID- 3RD5 ) was used as a template to predict the three dimensional model (Fig. 5e) of it. The predicted docking model (Fig |
| 237 | 6nb6 | - | https://www.sciencedirect.com/science/article/pii/S0021925817484729 | SARS-CoV-2 (COVID-19) structural and evolutionary dynamicome: Insights into functional evolution and human genomics | 2020 | R Gupta, J Charron, CL Stenger, J Painter- Journal of Biological, 2020 - Elsevier | receptor structure -function. post-translational modification (PTM). COVID-19. severe acute respiratory coronavirus 2 (SARS-CoV-2) Their 2633-kb genome consists of positive-sense, single-stranded RNA, coding for nonstructural and structural proteins This protein complex model was built through the integration of PDB structures 6CRW, 6NB6, and 5X58 for the trimer of spike proteins with 6M17, |
| 238 | 5i7w | - | https://onlinelibrary.wiley.com/doi/abs/10.1111/jeu.12834 | Characterization of Cystathionine Synthase TtCbs1 and Cysteine Synthase TtCsa1 Involved in Cysteine Biosynthesis in Tetrahymena thermophila | 2020 | H Lv, J Xu, T Bo, W Wang- Journal of Eukaryotic Microbiology, 2020 - Wiley Online Library | TtCsa1 has more than 30% sequence identities with B. abortus CS ( PDB ID: 5JIS) (Dharavath et al. 2017), B. suis CS ( PDB ID: 5I7W ), and L. major CS ( PDB ID: 4AIR) (Fyfe et al. 2012), and we modeled the overall structure of TtCsa1 with these crystal structures |
| 239 | 6nb7 | - | https://www.nature.com/articles/s41598-020-73820-8 | Hot spot profiles of SARS-CoV-2 and human ACE2 receptor protein protein interaction obtained by density functional tight binding fragment molecular orbital | 2020 | H Lim, A Baek, J Kim, MS Kim, J Liu, KY Nam- Scientific reports, 2020 - nature.com | the hot spot region, we also performed the same calculation with RBD-SARS-CoV-1/antibody complexes (five experimental structural data All experimental structures calculated in this work are summarized in Table 1. All missing side chains were filled using Prime implemented |
| 240 | 6q05 | - | https://www.journal.atmph-specialissues.org/uploads/179/8422_pdf.pdf | A Review of Current Literature on sudden Upsurge of COVID-19 | 2020 | R Sharma- Annals of Tropical Medicine and Public, 2020 - journal.atmph-specialissues.org | 6Q05 MERSCoV S structure in complex with SialylLewis Available from: http://www.rcsb.org/ pdb /results/results.do?tabtoshow=Unreleased and qrid=7E90BED0 coronavirus papain-like novel protease inhibitors: Design, synthesis, protein-ligand X-ray structure and biological |
| 241 | 4wi1 | - | https://www.preprints.org/manuscript/202010.0576 | Phytochemical, biological and computational investigations of Erythrina fusca Lour. to assess antimalarial property against Plasmodium falciparum | 2020 | SA Sazed, O Islam, SL Bliese, MRH Hossainey - 2020 - preprints.org | All these sub structures impose a chemical structure that has a resemblance only with phaseolin Phaseolin) was subjected to molecular docking study against various proteins of Pf (4plz, 4qt2,4r1e, 4r6w, 4wi1 , 4zxg, 5e16, 5jaz, 5k8s, 5znc, 6aqs, 6ee4, 6fba and 6i4b pdb id |
| 242 | 5vwm | - | https://www.sciencedirect.com/science/article/pii/S0968089620306568 | N-Hydroxyformamide LpxC inhibitors, their in vivo efficacy in a mouse Escherichia coli infection model, and their safety in a rat hemodynamic assay | 2020 | T Furuya, AB Shapiro, J Comita-Prevoir- Bioorganic & Medicinal, 2020 - Elsevier | Fig. 2. Key interactions in the LpxC enzyme binding pocket observed in P. aeruginosa LpxCCHIR-090 (3) co-crystal structure ( PDB code: 5VWM ). We first implemented a docking model using the ICM-Pro software (Molsoft) based on the available co-crystal structures of P |
| 243 | 5vm8 | - | https://journals.plos.org/ploscompbiol/article?id=10.1371/journal.pcbi.1007904 | Restriction of S-adenosylmethionine conformational freedom by knotted protein binding sites | 2020 | AP Perlinska, A Stasiulewicz- PLOS Computational, 2020 - journals.plos.org | depicted with rainbow coloring (TrmD, PDB ID: 4yvg), (B) unknotted methyltransferase (Trm5, PDB ID: 2zzm On the top of this it was shown that the structure of the knotted core Different conformations of the ligand imply differences in both structural and chemical characteristics of |
| 244 | 3krs | - | https://www.mdpi.com/2076-2607/8/1/40 | Gene Cloning, Recombinant Expression, Characterization, and Molecular Modeling of the Glycolytic Enzyme Triosephosphate Isomerase from Fusarium oxysporum | 2020 | B Hernndez-Ochoa, S Gmez-Manzo- Microorganisms, 2020 - mdpi.com | Triosephosphate isomerase (TPI) is a glycolysis enzyme, which catalyzes the reversible isomerization between dihydroxyactetone-3-phosphate (DHAP) and glyceraldehyde-3-phosphate (GAP). In pathogenic organisms, TPI is essential to obtain the energy used to survive and infect ... Figure 2. Bioinformatic analysis of FoxTPI with other triosephosphate isomerases (TPIs)... , 3KRS (Cryptosporidium Parvum), 5UPR (Toxoplasma gondii), |
| 245 | 6c9e | - | https://escholarship.org/uc/item/5rh0j6b2 | Molecular and shell biologyexamining the biochemistry and physiology of prokaryotic nanocompartments | 2020 | RJ Nichols - 2020 - escholarship.org | (B) Size comparison of the nanocompartments to GFP [ PDB : 1C4F], the HK97 viral capsid [ PDB : 1OHG], and the Lastly, given that there is no known structure of a DyP- packaging encapsulin, these nanocompartments may have a pore architecture that permits transit |
| 246 | 2mj3 | - | https://scholarship.rice.edu/handle/1911/108341 | Understanding and modulating electron transfer through ferredoxins | 2020 | I Campbell - 2020 - scholarship.rice.edu | 3.6. Cyanophage Fd structural characterization ..... 79 This bioinformatic study highlights understudied PECs whose structure , stability, and partner specificity should be further characterized... 1UWM, 1PDX, 1M2D, 1I7H, 3AH7, 2MJD, 2MJ3, 2Y5C, 5FFI, 3P1M, 1E0Z, 1DOI |
| 247 | 4wgj | - | https://www.biorxiv.org/content/10.1101/2020.04.17.046482v1.abstract | Bartonella effector protein C mediates actin stress fiber formation via recruitment of GEF-H1 to the plasma membrane | 2020 | S Marlaire, C Dehio- BioRxiv, 2020 - biorxiv.org | On the 130 structural level, BepC displays the ancestral FIC-OB-BID architecture . However, 131 replacement of an acidic residue (D/E) by a lysine (K). The crystal structure of the 134 the - and -phosphates of the ATP analog ( PDB : 4WGJ ), thus functionally replacing 137 |
| 248 | 3o2e | - | https://portlandpress.com/bioscirep/article-abstract/doi/10.1042/BSR20202956/226... | Sinorhizobium meliloti YrbA binds divalent metal cations using two conserved histidines | 2020 | T Roret, G Alloing, JM Girardet, T Perrot- Bioscience, 2020 - portlandpress.com | protein structures found in the protein databank, we tentatively attributed the changes to the Interestingly, a structure of a BolA_H from the pathogen Coxiella burnetii ligating a Co atom was solved in the frame of a structural genomic initiative for drug design, deposited in ...The coordinates of A. thaliana, B. bovis, and C. burnetii BolA proteins are from previous crystal structures (PDB entries 4PUG, 4PUH, 4PUI, 3O2E and 3TR3) |
| 249 | 3sw5 | 3fq3 | https://link.springer.com/article/10.1134/S0006297920030086 | Effect of Structure Variations in the Inter-subunit Contact Zone on the Activity and Allosteric Regulation of Inorganic Pyrophosphatase from Mycobacterium tuberculosis | 2020 | RS Romanov, SA Kurilova, AA Baykov- Biochemistry (Moscow, 2020 - Springer | of Ec PPase [15, 16], and bound L malate was found in the crystal struc ture of PPase from Bartonella henselae ( PDB ID 3SW5 ) Furthermore, modification of the subunit contact zones does not change the oligomeric structure of Mt PPase, but makes it less compact, as shown |
| 250 | 5i1f | - | https://www.mdpi.com/1422-0067/21/1/280 | GTP Preference of d-Glycero--d-manno-Heptose-1-Phosphate Guanylyltransferase from Yersinia pseudotuberculosis | 2020 | S Kim, MS Kim, S Jo, DH Shin- International Journal of Molecular, 2020 - mdpi.com | 2). In the case of GalU from Burkholderia vietnamiensis (BvGalU, PDB ID: 5I1F ), there are two In contrast, some of AMPPN bound structures can be searched in the PDB ( PDB ID: 5KQ8 an induced-fit conformational change when they interact with GMPPN in the crystal structure |
| 251 | 4noz | 4mh4 | https://pubs.acs.org/doi/abs/10.1021/acscatal.0c01257 | Substrate and product-assisted catalysis: molecular aspects behind structural switches along Organic Hydroperoxide Resistance Protein catalytic cycle | 2020 | R Mateus Domingos, RD Teixeira, A Zeida- ACS, 2020 - ACS Publications | The Ohr active site architecture is composed of two cysteines structures (Figure S1). Notably, when analyzing the other Ohr structures available in the PDB , we observed that the position of the Arg-loop in the Bacillus subtilis OhrB (BsOhrB) structure presents an intermediate |
| 252 | 6wpt | - | https://www.mdpi.com/866546 | The SARS-CoV-2 spike glycoprotein as a drug and vaccine target: Structural insights into its complexes with ACE2 and antibodies | 2020 | AC Papageorgiou, I Mohsin- Cells, 2020 - mdpi.com | 3. S protein Structural Details The reported structure revealed an asymmetric trimer and two conformations for one of the RBDs: up and down (Figure 3). The ACE2 binding was recently investigated in more detail, resulting in ten structures with the RBDs at different stages of ... Cryo-Electron Microscopy (Cryo-EM) structure of S309 antibody with the S glycoprotein trimer (PDB id 6wpt). The antibody chains are colored in cyan (L chain) and cornflower blue (H chain) |
| 253 | 5vog | - | https://scripts.iucr.org/cgi-bin/paper?ba5306 | ALIXE: a phase-combination tool for fragment-based molecular replacement | 2020 | C Milln, E Jimnez, A Schuster- Section D: Structural, 2020 - scripts.iucr.org | 2.4.1. Hypothetical protein ( PDB entry 5vog ). The crystal structure of a hypothetical protein from Neisseria gonorrhoeae with bound ppGpp was downloaded from the PDB ( PDB entry 5vog ; Seattle Structural Genomics Center for Infectious Disease, unpublished work) |
| 254 | 4iuj | - | https://ecommons.udayton.edu/uhp_theses/264/ | Toward a PA-Inhibitor Complex Crystal System: Influenza Polymerase Acidic Protein Fusion Constructs and Protein Expression | 2020 | R Kramb - 2020 - ecommons.udayton.edu | Figure 5 b (right) apo-PA crystal packing. PA ( PDB ID: 4IUJ ) is rendered as a surface, and a loop interest, our approach is to create different protein fusions of PA that will alter the crystal packing structure of PA, which could allow the visualization of the apo protein through |
| 255 | 3tjr | - | https://www.biorxiv.org/content/10.1101/2020.07.15.204123v2.abstract | On the Emergence of P-Loop NTPase and Rossmann Enzymes from a Beta-Alpha-Beta Ancestral Fragment | 2020 | LM Longo, J Jablonska, P Vyas, R Kolodny, N Ben-Tal- bioRxiv, 2020 - biorxiv.org | between Rossmanns and P-loops, ideally with respect to not only structure but also sequence 2003.1.1.417; PDB : 1k2w) and short chain dehydrogenase (F-Group 2003.1.1.332; PDB : 3tjr ) showing the highest overlap (Figure 4) |
| 256 | 3h81 | - | https://link.springer.com/content/pdf/10.1007/s12275-020-0089-1.pdf | Structural and sequence comparisons of bacterial enoyl-CoA isomerase and enoyl-CoA hydratase | 2020 | J Hwang, CS Jeong, CW Lee, SC Shin, HW Kim- Journal of, 2020 - Springer | (D) The electrostatic surface potential of the trimeric HyECH structure also shows that the periphery of the putative ligand-binding site has a positive charge MtECH, ECH from M. tuberculosis ( PDB code 3H81 ). Page 7. Crystal structures of BoECI and HyECH 7 |
| 257 | 4wi1 | - | https://www.mdpi.com/1422-0067/21/11/3803 | Identification of Selective Novel Hits against Plasmodium falciparum Prolyl tRNA Synthetase Active Site and a Predicted Allosteric Site Using in silico Approaches | 2020 | DW Nyamai, Tastan Bishop- International Journal of Molecular, 2020 - mdpi.com | (B) 2D representation of (a) SANC184; (b) SANC257; (c) SANC264; (d) SANC456; (e) SANC622 (f) TCMDC-124506 ( PDB ID: 4WI1 ); (g) glyburide ( PDB ID: 5IFU SANC236 ligand was unstable during the 20 ns simulation with structure flips at 10, 30, 95, 160, and 180 ns of the |
| 258 | 3h7f | - | https://scripts.iucr.org/cgi-bin/paper?rr5190 | Extending the scope of coiled-coil crystal structure solution by AMPLE through improved ab initio modelling | 2020 | JMH Thomas, RM Keegan, DJ Rigden- Section D: Structural, 2020 - scripts.iucr.org | This led to the solution of five new structures ( PDB entries 2v71, 3cvf, 3h7f , 3mqc and 3trt) in As an example, PDB entry 3mqc failed to solve using default models (Fig 3b), through an ensemble that included substantial common helical structure with deviation at either end (Fig |
| 259 | 3mx6 | - | https://www.mdpi.com/2218-273X/10/4/659 | P1 Residue-Oriented Virtual Screening for Potent and Selective Phosphinic (Dehydro) Dipeptide Inhibitors of Metallo-Aminopeptidases | 2020 | M Talma, A Mucha- Biomolecules, 2020 - mdpi.com | 20 to keep the size similar to the grid from the first step (36 for PDB : 2EK8 In general, the structure proposed here surpasses known inhibitors As the overall architecture of the S1 binding sites of porcine, bacterial, and protozoal APNs is rather conserved, the advantageous ... Table 1. Cont. Rickettsia prowazekii 3MX6 [41] |
| 260 | 4hjh | - | https://www.mdpi.com/1422-0067/21/24/9341 | Genomic Analysis of Natural Rough Brucella melitensis Rev. 1 Vaccine Strains: Identification and Characterization of Mutations in Key Genes Associated with | 2020 | D Kornspan, R Lubkovskaia, S Mathur- International journal of, 2020 - mdpi.com | through all homologs (Figure 2A). To evaluate the possible effect of the detected mutation on protein functionality, we conducted a structural analysis of the amino acid sequence of GST based on the solved 3D structure of this protein from Sinorhizobium meliloti ( PDB ID 4MDC) ... we conducted a structural analysis of the amino acid sequence of phosphomannomutase based on the solved 3D structure of its paralog phosphoglucomutase (PDB ID 4HJH, |
| 261 | 3ujh | - | https://www.nature.com/articles/s41598-020-75650-0 | When a foreign gene meets its native counterpart: computational biophysics analysis of two PgiC loci in the grass Festuca ovina | 2020 | Y Li, S Mohanty, D Nilsson, B Hansson, K Mao- Scientific reports, 2020 - nature.com | F. ovina. Using simulated native-state ensembles, we examine the structural properties and binding tightness of the dimers. In addition, we investigate their ability to withstand dissociation when pulled by a force. Our results |
| 262 | 3r9r | - | https://www.freepatentsonline.com/y2020/0297660.html | APPLICATIONS OF SPERMINE AND DERIVATIVES THEREOF | 2020 | W Pan, W Zhu- US Patent App. 16/889,500, 2020 - freepatentsonline.com | pneumonia (4FGR, 4FE2), Mycobacterium abscessus ATCC 19977/DSM 44196 ( 3R9R ), Thermotoga maritime On the basis of the above results, the crystal structure conformations in synthetases of Saccharormyces cerevisiae ( PDB : 2CNQ) and Escherichia coli ( PDB : 2GQS) are |
| 263 | 4dgq | - | http://s-space.snu.ac.kr/handle/10371/167820 | Structural and Biophysical Characterization of human NDRG3, a key component of lactate-induced hypoxia responses | 2020 | - 2020 - s-space.snu.ac.kr | 85 Figure 49 Structural comparison of C rmsd values at 5 mM and 87 Figure 51 Molecular dynamic simulation on NDRG3 C30S structure for 100 picoseconds PCR Polymerase chain reaction PDB Protein data bank PEG Polyethylene glycol |
| 264 | 4iv5 | - | https://search.proquest.com/openview/23ab9486a9345db9395c7632a37426cc/1?pq-origs... | Theory, Design and Characterization of Protein Symmetry Combination Materials | 2020 | J Laniado - 2020 - search.proquest.com | The symmetry group of a structure can be used to understand how many structurally distinct contact types are required to hold all the Current Opinion in Structural Biology 2016, 39:134143 built into a protein building block in order for it to assemble into the desired architecture |
| 265 | 4kam | - | https://www.nature.com/articles/s42003-020-0954-9 | Adaptive laboratory evolution enhances methanol tolerance and conversion in engineered Corynebacterium glutamicum | 2020 | Y Wang, L Fan, P Tuyishime, J Liu, K Zhang- Communications, 2020 - nature.com | Synthetic methylotrophy has recently been intensively studied to achieve methanol-based biomanufacturing of fuels and chemicals. However, attempts to engineer platform microorganisms to utilize methanol mainly focus on enzyme and pathway engineering... The model structure of the wild-type Cgl0653 was constructed with the crystal structure of O-acetyl-L-homoserine sulfhydrylase from Mycobacterium marinum ATCC BAA-535 (PDB ID: 4KAM) as a template (54% sequence identity with Cgl0653) |
| 266 | 6tys | - | https://www.mdpi.com/1999-4915/12/3/342 | Structural insight into paramyxovirus and pneumovirus entry inhibition | 2020 | M Aggarwal, RK Plemper- Viruses, 2020 - mdpi.com | 19,20,21] have furthermore created a novel opportunity for structure -informed mechanistic Structural information is very limited compared to that available for the paramyxovirus attachment Consequently, crystal structures of prefusion PIV5 and NiV F ectodomains could only be |
| 267 | 3uam | - | https://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.15203 | Characterization of a bacterial copperdependent lytic polysaccharide monooxygenase with an unusual second coordination sphere | 2020 | A Munzone, B El Kerdi, M Fanuel- The FEBS, 2020 - Wiley Online Library | by a glycine instead [23,24,26]. Additionally, a crystal structure of a putative AA10 LPMO from Burkholderia pseudomallei with a methionine in place of the alanine was released in the Protein Data Bank ( PDB accession code 3UAM ) |
| 268 | 3gbz | - | https://pubs.rsc.org/en/content/articlehtml/2020/me/c9me00097f | How evolution designs functional free energy landscapes of proteins? A case study on emergence of regulation in CDK family kinases. | 2020 | Z Shamsi, D Shukla- Molecular Systems Design & Engineering, 2020 - pubs.rsc.org | structures of CDK2 ( PDB ID: 5OSM, 6Q3F, 6Q4A, 6Q4B, 6Q4C, 6Q4D, 6Q4K), G/CDK ( PDB ID: 3GBZ ), and pfpk5 structures are native-like based on GA341 score and have comparable DOPE score with CDK2 native structure as shown in PDB ID for CMGI for native CDK2 score |
| 269 | 4jgb | 4jga | https://royalsocietypublishing.org/doi/abs/10.1098/rsob.200099 | TAK1: a potent tumour necrosis factor inhibitor for the treatment of inflammatory diseases | 2020 | J Totzke, SA Scarneo, KW Yang- Open, 2020 - royalsocietypublishing.org | A general core structure for type II binders has been developed, consisting of a hydrophobic moiety Structural disorder of this region is often cited as a reason for the missing residues of Ligand 10 (purple, PDB 4JGA), 11 (orange, PDB 4JGB ) and 12 (dark green, PDB 4JGD) are |
| 270 | 3t7c | 3s55 | https://www.biorxiv.org/content/10.1101/2020.10.15.341941v1.abstract | Structural studies on M. tuberculosis decaprenyl phosphoryl--D-ribose epimerase-2 enzyme involved in cell wall biogenesis | 2020 | SP Gangwar, A Bandyopadhyay, AK Saxena- bioRxiv, 2020 - biorxiv.org | The MtbDprE2 structure was aligned with structures of PDB database using TM- structural alignment program of I-TASSER server, which yielded ten closest structural homologs (as coverage=97.2% [54] (vi) PDB - 3t7c , identity=13.3%, coverage=97.2% [55] (vii) PDB -1ipe |
| 271 | 4f4f | 3v7n | https://link.springer.com/article/10.1007/s11030-020-10129-8 | Modeling and simulation study to identify threonine synthase as possible drug target in Leishmania major | 2020 | RJ Meshram, KT Bagul, SU Aouti, AM Shirsath- Molecular Diversity, 2020 - Springer | conformational changes. Moreover, we address some important structural and dynamic interactions in the PLP binding region of TS that are in good agreement with previously speculated crystallographic estimations. Additionally |
| 272 | 3gwc | - | https://www.sciencedirect.com/science/article/pii/S0006349520308894 | Mechanism of naphthoquinone selectivity of thymidylate synthase ThyX | 2020 | H Myllykallio, HF Becker, A Aleksandrov- Biophysical Journal, 2020 - Elsevier | to be very small, less than 0.1 kcal mol 1 . To model C8-C1 in complex with ThyX from Mtb, the C8-C1 ligand from the crystal structure from PBCV-1 was retained after superimposing the crystal structures from ThyX and PBCV-1( PDB : 4FZB, 3GWC ) using the |
| 273 | 3v7o | 5dvw | https://www.sciencedirect.com/science/article/pii/S0006291X20303636 | Crystal structure of the Mngl virus VP30 C-terminal domain | 2020 | S Dong, K Wen, H Chu, H Li, Q Yu, C Wang- and Biophysical Research, 2020 - Elsevier | VP30 CTD dimers formed from adjacent crystallographic asymmetric units with those of MARV ( PDB code: 5T3W), RESTV ( PDB code: 3V7O ) and EBOV ( PDB code: 5T3T) In this study, we determined the crystal structure of MLAV VP30 CTD monomer at 1.4 resolution |
| 274 | 3gwc | - | https://pubs.acs.org/doi/abs/10.1021/acsomega.0c01224 | dUMP/F-dUMP Binding to Thymidylate Synthase: Human Versus Mycobacterium tuberculosis | 2020 | K Gaurav, T Adhikary, P Satpati- ACS omega, 2020 - ACS Publications | Thymidylate synthase is an enzyme that catalyzes deoxythymidine monophosphate (dTMP) synthesis from substrate deoxyuridine monophosphate (dUMP). Thymidylate synthase of Mycobacterium tuberculosis (... (a) X-ray structure of MtbThyX (homotetramer; monomeric units are in yellow, cyan, green and purple, PDB 3GWC(16)). Each ligand-binding site (out of four) is at the intersection of three monomeric units. |
| 275 | 4dq8 | - | https://link.springer.com/article/10.1007/s00044-020-02519-2 | Green synthesis, antitubercular evaluation, and molecular docking studies of ethyl 3, 5-dicyano-6-oxo-2, 4-diarylpiperidine-3-carboxylate derivatives | 2020 | T Sekhar, P Thriveni, K Ramesh, PG Prasad- Medicinal Chemistry, 2020 - Springer | Full size image. Fig. 4 figure4. a 3D structure view of molecular docking of compound 4c (green sticks) with Mycobacterium AckA protein (gray lines) The PDB file of the target protein downloaded from RCSB PDB (www.rcsb.org), AckA (PDBID: 4DQ8 ) |
| 276 | 4g50 | 3uqb | https://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.0c00911 | Targeting Protein Folding: A Novel Approach for the Treatment of Pathogenic Bacteria | 2020 | NJ Scheuplein, NM Bzdyl, EA Kibble- Journal of Medicinal, 2020 - ACS Publications | Infectious diseases are a major cause of morbidity and mortality worldwide, exacerbated by increasing antibiotic resistance in many bacterial species. The development of drugs with new modes of act... |
| 277 | 4hvt | - | https://www.sciencedirect.com/science/article/pii/S0141022920300417 | Characterization and rational design for substrate specificity of a prolyl endopeptidase from Stenotrophomonas maltophilia | 2020 | J Yu, J Wu, D Xie, L Du, YJ Tang, J Xie- Enzyme and Microbial, 2020 - Elsevier | from Rickettsia typhi ( PDB ID: 4 HV T, https://www.rcsb.org/ structure / 4HVT ) as template The structure of SmPEP was built by the Swiss Model server and crystal structure ( PDB ID: 4 On the basis of the simulated structure , Arg263 cannot form the original ring stacking with Phe479 |
| 278 | 4g7f | - | https://www.sciencedirect.com/science/article/pii/S1093326319305844 | In silico repositioning of etidronate as a potential inhibitor of the Trypanosoma cruzi enolase | 2020 | EA Valera-Vera, M Say, C Reigada- Journal of Molecular, 2020 - Elsevier | Preparation of the PDBQT files (Protein Data Bank, partial charge (Q), and atom type (T)) was performed using AutoDock Tools v1.5.6 [29]. A search in the Protein Data Bank ( PDB ) [30] was carried to find the crystal structure of TcENO ( PDB ID: 4G7F , Resolution: 2.4 , R |
| 279 | 4g5d | - | https://parasitesandvectors.biomedcentral.com/track/pdf/10.1186/s13071-020-3883-... | Leishmania braziliensis prostaglandin F | 2020 | EVC AlvesFerreira, TR Ferreira, P Walrad - 2020 - parasitesandvectors.biomedcentral | 1b) and the 3D structure (Fig c 3D sequence alignments of protein sequences of LmjPGF2S (PBD ID 4G5D , in grey) and human ortholog share 51.4% similarity and 34.3% identity, modelling using the Research Collabora- tory for Structural Bioinformatics (RCSB) PDB suggests |
| 280 | 4g5d | - | https://link.springer.com/article/10.1186/s13071-020-3883-z | Leishmania braziliensis prostaglandin F2 synthase impacts host infection | 2020 | EVC Alves-Ferreira, TR Ferreira, P Walrad, PM Kaye- Parasites & vectors, 2020 - Springer | 1b) and the 3D structure (Fig c 3D sequence alignments of protein sequences of LmjPGF2S (PBD ID 4G5D , in grey) and human ortholog 51.4% similarity and 34.3% identity, modelling using the Research Collaboratory for Structural Bioinformatics (RCSB) PDB suggests that |
| 281 | 6bfu | 6nb6, 6nb7, 6nb3, 6tys, 6q04 | https://papers.ssrn.com/sol3/papers.cfm?abstract_id=3541361 | Candidate targets for immune responses to 2019-Novel Coronavirus (nCoV): sequence homology-and bioinformatic-based predictions | 2020 | A Grifoni, J Sidney, Y Zhang- -HOST-MICROBE-D, 2020 - papers.ssrn.com | with data about immune epitopes, protein structures , and host responses to virus infections (Pickett et al., 2012) glycoprotein structure ( PDB : 6ACD). The calculated surface of the top 10 amino acid residues Non- structural protein 3b 2 0 Protein 7a 2 0 Protein 9b 2 0 |
| 282 | 3gka | - | https://link.springer.com/article/10.1007/s00253-019-10287-2 | Two new ene-reductases from photosynthetic extremophiles enlarge the panel of old yellow enzymes: CtOYE and GsOYE | 2020 | MS Robescu, M Niero, M Hall, L Cendron- Applied Microbiology, 2020 - Springer | The most peculiar structural features of each enzyme are depicted in bright orange (loop 3 In the active site of GsOYE structure , a chloride anion, present in the crystallization In the structures of the GsOYE complexes, both para-hydroxybenzaldehyde (pHBA; PDB : 6S31) (Fig |
| 283 | 3o0h | - | http://s-space.snu.ac.kr/handle/10371/166700 | Structure of flavoprotein RclA from food-borne pathogens, and its molecular mechanism contributing to hypochlorous acid resistance | 2020 | - 2020 - s-space.snu.ac.kr | representation is labeled with residue numbers of three proteins (first RclA, second 3O0H , third 4M52). Page 36. 26 3.4 I searched for the closest protein to RclA in terms of structure using the DALI server (30). Mercuric reductase (MerA) ( PDB code: 4K7Z), a group II FDR |
| 284 | 6nb6 | - | https://www.mdpi.com/2218-273X/10/9/1346 | Recognition of Potential COVID-19 Drug Treatments through the Study of Existing ProteinDrug and ProteinProtein Structures: An Analysis of Kinetically Active | 2020 | O Perii- Biomolecules, 2020 - mdpi.com | their binding free energies to the COVID-19 structural and non- structural protein sites The structure alignment, hydrophobicity calculation, visualization and analyses were performed with the programs Chimera each protein chain that forms a protein complex (given as a PDB file |
| 285 | 3uqa | - | https://academic.oup.com/nar/article-abstract/48/3/1531/5661091 | AtFKBP53: a chimeric histone chaperone with functional nucleoplasmin and PPIase domains | 2020 | AK Singh, A Datta, C Jobichen, S Luan- Nucleic Acids, 2020 - academic.oup.com | this PPIase with histone chaperoning activity, we have solved the crystal structures of its a pentameric nucleoplasmin-fold; making this the first report of a plant nucleoplasmin structure The crystal structure of AtFKBP53 FKBD (residues 360–477) was solved by molecular replacement method with the help of program MolRep (52) from CCP4 suite, using the coordinates of the A54E mutant of Burkholderia pseudomallei FKBP-FK506 complex structure as a search model (PDB ID: 3UQA), but without FK506. |
| 286 | 3tsm | - | https://www.jbc.org/content/early/2020/09/14/jbc.RA120.014936.short | Structure and kinetics of indole-3-glycerol phosphate synthase from Pseudomonas aeruginosa-decarboxylation is not essential for indole formation | 2020 | A Sderholm, MS Newton, WM Patrick- Journal of Biological, 2020 - ASBMB | catalytic residues taking part in the dehydration step are harder to speculate on due to the substantial structural rearrangements taking However, a different open conformation of helix 0 is observed in the structure of IGPS from Brucella melitensis ( PDB 3TSM , unpublished |
| 287 | 5j3b | - | https://edoc.ub.uni-muenchen.de/26990/ | The translation elongation factor P in actinobacteria | 2020 | B Pinheiro Damasceno Florentino - 2020 - edoc.ub.uni-muenchen.de | NC Nascent peptide-chain ORF Open reading frame PCR Polymerase chain reaction PDB Protein data EF- P facilitates translation of XPPX motifs is based in many structural studies... Structural superposition and ribbon representations of available EF-P structures. C. glutamicum (PDB code 6S8Z, orange, this work), Acinetobacter baumannii (PDB code: 5J3B, blue), E. coli ( |
| 288 | 6nb8 | - | https://saudijournals.com/media/articles/SIJB_36_143-153.pdf | Drug Targets for Corona Virus (COVID-19): A Systematic Review | 2020 | K Jayakumar - 2020 - saudijournals.com | to neutralize it, and their structures are also available ( PDB IDs: 6NB6, 6NB7, and 6NB8 .The monoclonal antibody, m396, has a competitive role for RBD binding ( PDB ID: 2DD8 However, the structure is highly variable among different members of the CoV family |
| 289 | 5j3b | - | https://www.sciencedirect.com/science/article/pii/S2211124720303089 | Structure and Function of an Elongation Factor P Subfamily in Actinobacteria | 2020 | B Pinheiro, CM Scheidler, P Kielkowski, M Schmid- Cell Reports, 2020 - Elsevier | In order to gain insights into the structural configuration of this Actinobacteria EF-P, we X-ray crystal structure to 2.2- resolution (for data processing and structure refinement statistics its overall folding topology with the previously reported bacterial EF-P structures and consists of |
| 290 | 2lwk | - | https://deepblue.lib.umich.edu/handle/2027.42/155127 | Using Machine Learning to Better Predict the Structure of RNA and RNA Containing Complexes | 2020 | S Chhabra - 2020 - deepblue.lib.umich.edu | 53 3.5 Top 10 RNA Structures for 2LWK predicted from sequence using CS-Fold and Rosetta structures . The statistics from Protein Data Bank ( PDB ) (http://www.rcsb.org) current understanding of the RNA structure -function relationships is limited due to |
| 291 | 4f47 | - | https://pubs.acs.org/doi/abs/10.1021/acsinfecdis.0c00329 | Post-translational Succinylation of Mycobacterium tuberculosis Enoyl-CoA Hydratase EchA19 Slows Catalytic Hydration of Cholesterol Catabolite 3-Oxo-chol-4,22 | 2020 | AC Bonds, T Yuan, JM Werman, J Jang- ACS Infectious, 2020 - ACS Publications | Cholesterol is a major carbon source for Mycobacterium tuberculosis (Mtb) during infection, and cholesterol utilization plays a significant role in persistence and virulence within host macrophages... |
| 292 | 4qtp | - | https://www.biorxiv.org/content/10.1101/674879v3.abstract | The SiaABC threonine phosphorylation pathway controls biofilm formation in response to carbon availability in Pseudomonas aeruginosa | 2020 | WH Poh, J Lin, B Colley, N Mller, BC Goh- BioRxiv, 2020 - biorxiv.org | SiaC crystal 319 structure , and an anti-sigma factor antagonist from Mycobacterium paratuberculosis ( PDB ID: 320 4QTP ; gene ID MAP_0380; Fig 6D) was identified as the closest homologue (Z score of 9.0, an 321 amino-acid sequence |
| 293 | 4h3e | - | http://www.publish.csiro.au/ch/ch19346 | The Crystal Structure of the Manganese Superoxide Dismutase from Geobacillus stearothermophilus: Parker and Blake (1988) Revisited | 2020 | JJ Adams, CJ Morton, MW Parker- Australian Journal of Chemistry, 2020 - CSIRO | determined primarily by X-ray crystallography, although one SOD structure has been SODs have also been determined from Pseudomonas putida (ovalis) ( PDB ID: 1dto acidocaldarius (1b06), [ 27 ] Acanthamoeba castellanii (6j55), [ 28 ] Trypanosoma cruzi ( 4h3e ), [ 29 ] Vigna |
| 294 | 4em6 | - | https://www.sciencedirect.com/science/article/pii/S0378874119324778 | Metabolomics coupled with SystemsDock reveal the protective effect and the potential active components of Naozhenning granule against traumatic brain injury | 2020 | J Cao, Y Duan, Y Liu, H Liu, C Wei, J Wang- Journal of, 2020 - Elsevier | Orthogonal projection to latent structure -discriminate analysis (OPLS-DA) was also applied to maximize the Compounds, Docking score(> 6.0), Proportion of protein(%), PDB entry, Source 47.2, 4JYU, 4BBE, 1GJO, 3GJS, 4UI1, 2OOW, 4JC1, 5XSR, 1X9D, 6EYI, 4EM6 , 1TJJ, 2OC2 |
| 295 | 5k85 | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/bio.3952 | Selective inhibition of Zophobas morio (Coleoptera: Tenebrionidae) luciferaselike enzyme luminescence by diclofenac and potential suitability for lightoff | 2020 | MC Carvalho, A Tomazini, RA Prado- Luminescence, 2020 - Wiley Online Library | tertiaricarbonis PDB file ID: 6HE0, Cryptococcus neoformans PDB file ID: 5K85 , Salmonella typhimurium PDB file ID: 5JRH) indicated that, among the five binding sites, that of CoA was structure and function prediction. Nat Protoc 2010; 5: 25-738. 49 |
| 296 | 6dj8 | - | http://ej.kubagro.ru/2020/07/pdf/11.pdf | COMPARISON OF STRUCTURAL PROTEIN OF SILKWORM DENSOVIRUS BMDNV-1 WITH PROTEINS OF VIRUSES OF BACTERIA AND ARCHAEA TO STUDY THE POSSIBILITY OF FALSE POSITIVE ANSWERS IN THE ELISA - TESTING OF CATERPILLARS | 2020 | Antonovich ZA, Nazipova NN, ..., Scientific Journal of KubSAU , 2020 - ej.kubagro.ru | PDB . . , SMTL ID : 6dj8 .1 ( Structure of DNA polymerase III subunit beta from Borrelia burgdorferi) |
| 297 | 3mmt | - | https://chemrxiv.org/ndownloader/files/24733793 | The Molecular Basis of Sulfosugar Selectivity in Sulfoglycolysis | 2020 | M Sharma, P Abayakoon, Y Jin, R Epa, JP Lingford - 2020 - chemrxiv.org | Figure S15. Closed conformations of PfkB, TPK and SF kinases indicate close structural rela- tionship EcYihVADPMgSF structure reveals KRN sulfonate recognition triad in YihV A, FBPA from Bartonella henselae forms homotetramers ( 3MMT . pdb ),{, 2011 #8494} FBPA from |
| 298 | 5ucm | - | https://books.google.com/books?hl=en&lr=&id=0-L7DwAAQBAJ&oi=fnd&pg=PA69&dq=%225U... | trans-Editing by aminoacyl-tRNA synthetase-like editing domains | 2020 | ABK Nagy, M Bakhtina- Biology of Aminoacyl, 2020 - books.google.com | bound by an autonomous trans- editing factor, such as C. crescentus ProXp-ala ( PDB ID: 5VXB PheRS is also unique in its oligomeric structure it is a heterote- tramer domain ( bound in an editing active conformation will be needed to fully understand the structural basis for |
| 299 | 5dld | 4hwg | https://www.teses.usp.br/teses/disponiveis/76/76132/tde-29092020-091852/en.php | UDP-N-acetilglicosamina 2-epimerase de Staphylococcus aureus: estrutura, dinmica e prospeco de novos ligantes | 2020 | C Azevedo - teses.usp.br | the crystallographic structure of the enzyme to characterize conformational changes as they 45 Figura 13 Estrutura cristalogrfica da cadeia A da protena UDP-GlcNac 2-epimerase de S. aureus ( PDB : 5ENZ), com uma molcula de UDP em stio ativo, vista de frente (A) e |
| 300 | 3cez | - | https://www.sciencedirect.com/science/article/pii/S0891584920311321 | On the functionality of a methionine sulfoxide reductase B from Trypanosoma cruzi | 2020 | DG Arias, MS Cabeza, ML Echarren- Free Radical Biology, 2020 - Elsevier | These enzymes can reduce specifically one or another of the isomers of MetSO (free and protein-bound). This redox modification could change the structure and function of many proteins, either concerned in redox or other metabolic pathways ... Models were based on the resolved structure of MSRB from Methanothermobacter thermautotrophicus (PDB 2K8D), Burkholderia pseudomallei (PDB 3CEZ), and Xanthomonas campestris (PDB 3HCI). |
| 301 | 4h3e | - | https://www.mdpi.com/2076-3921/9/11/1047 | Parallel Molecular Evolution of Catalases and Superoxide DismutasesFocus on Thermophilic Fungal Genomes | 2020 | K Chovanov, M Bhmer, A Poljovka, J Budi- Antioxidants, 2020 - mdpi.com | and heme catalases were obtained from Phyre-2 server [16] by employing the intensive mode with HMM and PSI-Blast for finding closest homologs with a known experimental structure . Obtained structural models were superimposed on experimental 3D structures using the |
| 302 | 2lwk | - | https://books.google.com/books?hl=en&lr=&id=0dwBEAAAQBAJ&oi=fnd&pg=PA332&dq=%222... | Maicol Bissaro, Mattia Sturlese and Stefano Moro | 2020 | K Kuca, M Tutone, E Malinowska- In Silico Methods for Drug, 2020 - books.google.com | against the PDB reference.(B) Superimposition between the experimental NMR complex ( PDB ID 2LWK , green-colored RMSD of RNA phosphate atoms belonging to the backbone, computed against the PDB reference E) Flexibility characterizing the RNA structure during DPQ |
| 303 | 4dz4 | - | https://repositorio.unesp.br/handle/11449/193031 | Elucidao estrutural da especificidade por substratos de enzimas da biossntese de aminoglicosdeos e marginolactonas | 2020 | TP Cardoso - 2020 - repositorio.unesp.br | Marginolactone. Structure . Page 9. Lista de Ilustraes AERUGINOSA: GPUA- Q9I6K2; S. CLAVULIGERUS: PAH - P0DJQ3; B. THAILANDENSIS: BUR- Q2T3W4 [ 4DZ4 CDIGO DO PDB ]; D.RADIODURANS: DR_AGM- Q9RZ04; B. CALDOVELOX |
| 304 | 4ed9 | - | http://broncoscholar.library.cpp.edu/handle/10211.3/215321 | Overexpression and Purification of the Protein BaiK for Structural Characterization by X-Ray Crystallography | 2020 | S Khuu - 2020 - broncoscholar.library.cpp.edu | Initially , BaiK was overexpressed to produce large quantity of protein for use in structural and structure being very similar to histidine while also being added at a high concentration. 11 formation of more ordered crystal structures . The effective concentration of the protein |
| 305 | 5j3b | - | https://www.sciencedirect.com/science/article/pii/S0969212620303737 | Structural Basis for Toxin Inhibition in the VapXD Toxin-Antitoxin System | 2020 | MB Bertelsen, M Senissar, MH Nielsen, F Bisiak- Structure, 2020 - Elsevier | Here, we provide structural insights into the architecture of the intact VapXD TA complex and toxin residues missing in each chain likely due to flexibility (Figure S1A). The structure consists of PDB Entry, VapXD (Selenomethionine) 6ZN8, VapD (Wild Type) 6ZI0, VapD (D7N) 6ZI1... (B) Structure of the Acinetobacter baumannii EF-P OB fold with conserved secondary structure in gold (PDB: 5J3B, left) and corresponding topology (right). |
| 306 | 3f0d | - | https://pubs.acs.org/doi/abs/10.1021/acsomega.0c01337 | Upgraded AMBER Force Field for Zinc-Binding Residues and Ligands for Predicting Structural Properties and Binding Affinities in Zinc-Proteins | 2020 | M Macchiagodena, M Pagliai, C Andreini, A Rosato- ACS, 2020 - ACS Publications | Journal Logo. Upgraded AMBER Force Field for Zinc-Binding Residues and Ligands for Predicting Structural Properties and Binding Affinities in Zinc-Proteins. Marina Macchiagodena Marina Macchiagodena. Dipartimento di |
| 307 | 3cez | 3cxk | https://www.liebertpub.com/doi/abs/10.1089/ars.2020.8037 | Structure and Electron-transfer Pathway of the Human Methionine Sulfoxide Reductase MsrB3 | 2020 | G Javitt, Z Cao, E Resnick, R Gabizon- and Redox Signaling, 2020 - liebertpub.com | MsrB3 molecules per asymmetric unit. The structure was solved by molecular replacement using a bacterial MsrB protein ( PDB code 3CEZ ) with high sequence identity to human MsrB3 (74 of 119 residues, or 62%) (6). Though the amino-terminal segment containing |
| 308 | 3cxk | - | https://www.sciencedirect.com/science/article/pii/S1570963920302223 | Functional characterization of methionine sulfoxide reductases from Leptospira interrogans | 2020 | N Sasoni, MD Hartman, SA Guerrero- et Biophysica Acta (BBA, 2020 - Elsevier | The Met oxidation could change the structure and function of many proteins, not only of those redox-related but also of others involved in different metabolic pathways. Until now, there is no information about the presence or function of Msrs enzymes in Leptospira interrogans |
| 309 | 3i4e | 3p0x | https://www.sciencedirect.com/science/article/pii/S0006291X20318970 | Biochemical properties and crystal structure of isocitrate lyase from Bacillus cereus ATCC 14579 | 2020 | SH Lee, D Ki, S Kim, IK Kim, KJ Kim- Biochemical and Biophysical, 2020 - Elsevier | 2.5. Structure determination of BcICL. The structure of BcICL was determined using the molecular replacement method with the CCP4 version of MOLREP [24]. The structure of Isocitrate lyase from Burkholderia pseudomallei ( PDB code 3I4E ) was used as a search model |
| 310 | 3dmp | 3qbp, 3e5b, 3hm0 | https://www.sciencedirect.com/science/article/pii/S1570963920301515 | Tetramer protein complex interface residue pairs prediction with LSTM combined with graph representations | 2020 | D Sun, X Gong- Biochimica et Biophysica Acta (BBA)-Proteins and, 2020 - Elsevier | The structure diagram of LSTM neural network is shown in Fig. 3. (See Fig. 1, Fig Table 1. Dataset. DataSet, PDB ID 2H8N, 2JBR, 2NQO, 2Y32, 3DFQ, 3ESI, 3G7K, 3HM0, 3OHP, 3RD4, 3 V15, 1IZ1, 1JL2. 1KAM, 1NSW, 2GJD, 2R90, 2ZYZ, 3CDK, 3CO2, 3DMP , 3F6Z, 1BV4, 1YIF |
| 311 | 6amz | - | https://www.sciencedirect.com/science/article/pii/S002251932030028X | Identification of potential therapeutic targets in Neisseria gonorrhoeae by an in-silico approach | 2020 | P Tanwer, SRR Kolora, A Babbar, D Saluja- Journal of Theoretical, 2020 - Elsevier | The obtained protein. pdb file was overlapped with the homologous protein whose crystal structure ( 6AMZ from Acinetobacter baumannii) was obtained from RCSB database (Berman et al., 2000). Both protein structures were overlapped using Pymol (Alexander et al., 2011) to |
| 312 | 3ek1 | 4o5h | https://trace.utk.edu/islandora/object/utk.ir.td%3A13699/datastream/PDF/download... | Cell-Free Enabled Bioproduction and Biological Discovery | 2020 | DC Garcia - 2020 - trace.utk.edu | The combined use of bioinformatic software and structural data has crystal structures or computationally modeled structures to further cull the listed Enzymatic steps are written above the colored arrows and names of ligands and products underneath their molecular structure |
| 313 | 6ar7 | - | https://www.mlsb.io/papers/MLSB2020_Learning_Super-Resolution_Electron_Density.p... | Learning Super-Resolution Electron Density Map of Proteins using 3D U-Net | 2020 | B Mullick, Y Wang, P Yadav, AB Farimani - mlsb.io | The mesh grid displays the electron density surface for the structure and the underlying line diagram represents the protein structure from the PDB file. (a) The electron density map of PDB ID: 6AR7 (Green), with resolution of 2.10 |
| 314 | 6bfu | - | https://journals.asm.org/doi/abs/10.1128/jvi.01301-20 | Cryo-electron microscopy structure of the swine acute diarrhea syndrome coronavirus spike glycoprotein provides insights into evolution of unique coronavirus spike | 2020 | H Guan, Y Wang, V Perulija, AFUH Saeed- Journal of, 2020 - Am Soc Microbiol | HCoV-NL63 ( PDB accession number 5SZS); (C) S trimer of the deltacoronavirus PdCoV ( PDB accession number 6BFU ); (D) S bronchitis virus (IBV) ( PDB accession number 6CV0); (E) S trimer of the betacoronavirus SARS-CoV ( PDB accession number 5X58 (F) Structure of the |
| 315 | 6bfu | - | https://www.nature.com/articles/s41594-020-0478-5 | A thermostable, closed SARS-CoV-2 spike protein trimer | 2020 | X Xiong, K Qu, KA Ciazynska, M Hosmillo- Nature Structural &, 2020 - nature.com | Structures of the disulfide-stabilized and non-disulfide-stabilized proteins reveal distinct closed and locked conformations of the S trimer with the target cell, and is a dominant target of the immune system 4 . S protein is trimeric and has two distinct structural statesprefusion ... porcine deltacoronavirus (PDCoV, a deltacoronavirus, PDBID: 6BFU). S proteins are structurally aligned based on S2. S protein trimers from all 4 genera of |
| 316 | 6bfu | - | https://academic.oup.com/ve/article-abstract/6/1/veaa003/5734706 | Unraveling virus relationships by structure-based phylogenetic classification | 2020 | WM Ng, AJ Stelfox, TA Bowden- Virus Evolution, 2020 - academic.oup.com | Unraveling virus relationships by structure -based phylogenetic classification. Weng M Ng. Division of Structural Biology, Wellcome Centre for Human Genetics, University of Oxford. ... human coronavirus NL63 (3KBH); human coronavirus 229E (6ATK); porcine deltacoronavirus, PDCoV (6BFU). All chains not comprising S1-CTD (e.g. receptor and antibody fragments) were removed prior to structural alignment |
| 317 | 6c49 | - | https://link.springer.com/article/10.1007/s12010-020-03400-z | In silico study of the structure and ligand interactions of alcohol dehydrogenase from cyanobacterium Synechocystis Sp. PCC 6803 as a key enzyme for biofuel | 2020 | O Haghighi, M Moradi- Applied Biochemistry and Biotechnology, 2020 - Springer | with amino acids in Zn ion binding sites along with a slight deviation between Cys 110 in the template and Cys 106 in the homology model in the location of structural Zn PCC 6803 homology model (Cyan) superimposed onto the template crystal structure ( PDB ID: 6C49 ) (Tan |
| 318 | 3iew | 3k2x | https://pubs.acs.org/doi/abs/10.1021/acs.jcim.0c00877 | Benchmark Sets for Binding Hot Spot Identification in Fragment-Based Ligand Discovery | 2020 | AE Wakefield, C Yueh, D Beglov- Journal of Chemical, 2020 - ACS Publications | Binding hot spots are regions of proteins that, due to their potentially high contribution to the binding free energy, have high propensity to bind small molecules. We present benchmark sets for te... |
| 319 | 5uxx | - | https://www.nature.com/articles/s41579-020-00450-2 | Diverse and unified mechanisms of transcription initiation in bacteria | 2020 | J Chen, H Boyaci, EA Campbell- Nature Reviews Microbiology, 2020 - nature.com | Transcription of DNA is a fundamental process in all cellular organisms. The enzyme responsible for transcription, RNA polymerase, is conserved in general architecture and catalytic function across the three domains of life. ... Fig 5 Mycobacterium tuberculosis σK–RskA (PDB ID 4NQW; panel Ae) 85, Bartonella quintana σE–NepR (PDB ID 5UXX: panel Af), |
| 320 | 6q04 | - | https://science.sciencemag.org/content/370/6520/1089.abstract | Structural analysis of full-length SARS-CoV-2 spike protein from an advanced vaccine candidate | 2020 | S Bangaru, G Ozorowski, HL Turner- , 2020 - science.sciencemag.org | Report. Structural analysis of full-length SARS-CoV-2 spike protein from an advanced vaccine candidate 1Department of Integrative Structural and Computational Biology, The Scripps Research Institute, La Jolla, CA 92037, USA |
| 321 | 6cfp | - | https://www.tandfonline.com/doi/abs/10.1080/07391102.2020.1806112 | New anti-viral drugs for the treatment of COVID-19 instead of favipiravir | 2020 | A Akta, B Tzn, R Aslan, K Sayin- Biomolecular Structure, 2020 - Taylor & Francis | According to Table 2, the 6CFP protein is not inhibited by any ligands RNA polymerase proteins with PDB IDs of 6NUR and 6NUS were reported in late 2019 and early In this calculation, the ligand and protein are flexible and solvent molecules surround the entire structure |
| 322 | 6d8w | - | https://www.sciencedirect.com/science/article/pii/S1201971219304175 | Molecular insights into evolution, mutations and receptor-binding specificity of influenza A and B viruses from outpatients and hospitalized patients in | 2020 | FX Ivan, X Zhou, SH Lau, S Rashid, JSM Teo- International Journal of, 2020 - Elsevier | Structural analyses of receptor-binding specificity Then, sialotrisaccharide 3'SLN and 6'SLN isolated from co-crystallized HA-ligand structures in Protein Data Bank ( PDB ) were respectively used as the avian and human receptor analogs to assess receptor-binding |
| 323 | 6c6b | - | https://www.sciencedirect.com/science/article/pii/S0141813020344470 | Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina | 2020 | FOS Ribeiro, GS de Arajo, MGA Mendes- International Journal of, 2020 - Elsevier | Volume 165, Part A, 15 December 2020, Pages 279-290. International Journal of Biological Macromolecules. Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina The 3D structures of all possible C. neoformans and M. canis targets were obtained from the Protein Data Bank (PDB) (Protein Data Bank, 2019) with the codes 2W3N (Carbonic anhydrase 2), 3Q73 (Farnesyl transferase), 5I33 (Adenylosuccinate synthetase), 5 U29 (Acetyl-coenzyme |
| 324 | 2khp | - | https://www.mdpi.com/1420-3049/25/1/147 | Identifying Ortholog Selective Fragment Molecules for Bacterial Glutaredoxins by NMR and Affinity Enhancement by Modification with an Acrylamide Warhead | 2020 | RB Khattri, DL Morris, SM Bilinovich, E Manandhar- Molecules, 2020 - mdpi.com | between the two domains, the presence of multiple paralogs in one or both species, and a lack of conserved genomic architecture between the Structural comparison of hGRX1 to E. coli GRX and BrmGRX indicated similarities in the overall fold and structure ... NMR backbone resonance assignments for BrmGRX (2KHP) and hGRX1 (1JHB) were obtained from the BMRB |
| 325 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 326 | 3oc6 | - | https://www.mdpi.com/1422-0067/21/14/4831 | Characterizing the Fused TvG6PD:: 6PGL Protein from the Protozoan Trichomonas vaginalis, and Effects of the NADP+ Molecule on Enzyme Stability | 2020 | L Morales-Luna, B Hernndez-Ochoa- International journal of, 2020 - mdpi.com | This report describes a functional and structural analysis of fused glucose-6-phosphate dehydrogenase dehydrogenase-phosphogluconolactonase protein from the protozoan Trichomonas vaginalis (T. vaginalis). The glucose-6-phosphate dehydrogenase (g6pd) gene ... Structural superposition of the 6PGL crystal structure from Mycolicibacterium smegmatis MC2 155 (PDB entry 3OC6, steel blue) with the C-terminal 6PGL region of the TvG6PD::6PGL model (spring green). |
| 327 | 3qi6 | 6cja | https://www.nature.com/articles/s41598-020-71756-7 | Catalytic specificity of the Lactobacillus plantarum cystathionine -lyase presumed by the crystallographic analysis | 2020 | Y Matoba, M Noda, T Yoshida, K Oda, Y Ezumi- Scientific Reports, 2020 - nature.com | The reverse transsulfuration pathway, which is composed of cystathionine -synthase (CBS) and cystathionine -lyase (CGL), plays a role to synthesize l-cysteine using l-serine and the sulfur atom in l-methionine. A plant-derived lactic acid bacterium Lactobacillus plantarum SN35N |
| 328 | 4dz4 | - | https://www.mdpi.com/1422-0067/21/11/4132 | Insights into the Mn2+ Binding Site in the Agmatinase-Like Protein (ALP): A Critical Enzyme for the Regulation of Agmatine Levels in Mammals | 2020 | MB Reyes, J Martnez-Oyanedel, C Navarrete- International Journal of, 2020 - mdpi.com | Using comparative modeling we generated a structural model of LIM-ALP, including the Mn 2+ binding site, but without considering the first presents the general folding of this protein family, presenting only differences in the length of some of the secondary structure elements |
| 329 | 5j3b | - | https://www.researchsquare.com/article/rs-51959/latest.pdf | How Signaling Games Explain Mimicry at Many Levels: From Viral Epidemiology to Human Sociology | 2020 | W Casey, S Massey, B Mishra - 2020 - researchsquare.com | Here we will further illustrate and discuss the sur- prisingly diverse dynamics expressed for a variety of population structures The process architecture is simple, but worth noting that each type in the population structure forms a component in the evolution processes ... factor (1EH1), Acinetobacter baumannii elongation factor P (5J3B), T.thermophilus |
| 330 | 6q06 | 3sia | https://www.mdpi.com/2076-393X/8/4/587 | Host Receptors of Influenza Viruses and CoronavirusesMolecular Mechanisms of Recognition | 2020 | N Sriwilaijaroen, Y Suzuki- Vaccines, 2020 - mdpi.com | A CoV structure with S and HE spikes and positions of S1-NTD and S1-CTD on the S IAVs from avians, either wild birds or domestic birds, typically prefer the 2, 3Sia terminal This representative viral HA is from pdb ID of 3ube, which showed a 2009 pandemic HA in complex... Side view of a surface diagram of a trimeric CoV S protein (pdb: 6q06 [148]) |
| 331 | 3laa | 4lgo, 3s6l | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7688925/ | Non-adaptive evolution of trimeric autotransporters in Brucellaceae | 2020 | MR Rahbar, M Zarei, A Jahangiri, S Khalili- Frontiers in, 2020 - ncbi.nlm.nih.gov | domain from Haemophilus influenzae genome ( PDB ID:1S7M; Yeo et al., 2004); structure of the parallel beta-roll collagen-binding domain of Yersinia enterocolitica adhesin YadA ( PDB ID: 1P9H Batch analyzes of the dataset suggested the existence of a few structural domains |
| 332 | 5cy4 | - | https://academic.oup.com/nar/article-abstract/48/10/5572/5828917 | Human REXO2 controls short mitochondrial RNAs generated by mtRNA processing and decay machinery to prevent accumulation of double-stranded RNA | 2020 | M Szewczyk, D Malik, LS Borowski- Nucleic acids, 2020 - academic.oup.com | Here, we report comprehensive functional, biochemical, and structural studies to elucidate REXO2 function in human mitochondria We also demonstrate that REXO2 degrades RNA in a structure - and sequence-dependent manner. ... The model that was used for molecular replacement was oligoribonuclease from Acinetobacter baumnii (PDB ID: 5CY4, Seattle Structure Genomics Centre for Infectious Diseases), which shares 48.3% sequence identity with REXO2. |
| 333 | 6ws6 | - | https://www.sciencedirect.com/science/article/pii/S1931312820303620 | Neutralizing antibody and soluble ACE2 inhibition of a replication-competent VSV-SARS-CoV-2 and a clinical isolate of SARS-CoV-2 | 2020 | JB Case, PW Rothlauf, RE Chen, Z Liu, H Zhao- Cell host &, 2020 - Elsevier | Using an infectious molecular clone of vesicular stomatitis virus (VSV) expressing eGFP as a marker of infection, we replaced the glycoprotein gene (G) with the spike protein of SARS-CoV-2 (VSV-eGFP-SARS-CoV-2) and developed a high-throughput-imaging-based neutralization assay at biosafety level 2 ... VIR antibody set Pinto et al., 2020 S309 PDB: 6WS6 |
| 334 | 6q06 | - | https://academic.oup.com/femsre/advance-article-abstract/doi/10.1093/femsre/fuaa... | Molecular diversity of coronavirus host cell entry receptors | 2020 | JK Millet, JA Jaimes, GR Whittaker- FEMS microbiology reviews, 2020 - academic.oup.com | boxes indicate genes encoding accessory proteins (ns2, ns4a, ns4b and ns5a), while green boxes indicate structural proteins B) Representative structure of coronavirus protein in pre-fusion (S1 and S2 subunits, PDB 3JCL) and post-fusion (S2 subunit, PDB 6B3O) conformations ...MERS-CoV NTD (PDB 6Q06), which binds sialosides with a preference for α2,3-linked sialic acids, |
| 335 | 6vju | - | https://www.biorxiv.org/content/10.1101/2020.12.23.424250v1.abstract | A novel deep-sea bacterial threonine dehydratase drives cysteine desulfuration and hydrogen sulfide production | 2020 | N Ma, Y Sun, W Zhang, C Sun- bioRxiv, 2020 - biorxiv.org | of psTD with mutation of R77E (R is mutated to E; PDB 7DAR) was also solved for 156 comparison 1P5J, 6VJU (1P5J: Ser dehydratase, 6VJU : Cys synthase), which is directly opened to 193 methods. Based on the structure of psTD, its mutant and complex with PLP, we 231 |
| 336 | 5bt8 | - | https://royalsocietypublishing.org/doi/abs/10.1098/rsob.200302 | Phosphoglycerate kinase: structural aspects and functions, with special emphasis on the enzyme from Kinetoplastea | 2020 | M Rojas-Pirela, D Andrade-Alvirez- Open, 2020 - royalsocietypublishing.org | bacteria, PGK, monomer, open, , 6I06, [39]. Acinetobacter baumannii, bacteria, PGK, monomer, , , 5BT8 , Fairman et al. (NA) Figure 3. Three-dimensional structure of phosphoglycerate kinase. (a) Ribbon representation of the overall structure of pig muscle PGK ( PDB : 1HDI) |
| 337 | 3t7c | 3pgx | http://www.ir.juit.ac.in:8080/jspui/handle/123456789/23859 | Identification of Genes Involved in IN VIVO Virulence of Mycobacterium Fortuitum as Potential Drug Target | 2020 | R Srivastava - 2020 - ir.juit.ac.in | acidic, hypoxic and detergent stress conditions. Structural and functional characterization of most potent ORF Mfsdr was done using in silico approaches. MfSdr was predicted to be acid synthesis. Secondary structure of MfSdr generated using Robetta server showed presence |
| 338 | 6mc0 | - | https://www.mdpi.com/864810 | High-Resolution Crystal Structure of Chloroplastic Ribose-5-Phosphate Isomerase from Chlamydomonas reinhardtiiAn Enzyme Involved in the Photosynthetic | 2020 | T Le Moigne, P Crozet, SD Lemaire, J Henri- International journal of, 2020 - mdpi.com | 4A). Structural superposition of CrRPI1 with RpiA from Legionella pneumophila (LpRPI, PDB : 6MC0 , RMSD = 0.734 We describe the first structure of a ribose-5-phosphate isomerase from a Viridiplanta The structural fold of CrRPI1 (Figure 1B) is similar to previously described |
| 339 | 6n41 | - | https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0234869 | Whole-genome sequencing reveals origin and evolution of influenza A (H1N1) pdm09 viruses in Lincang, China, from 2014 to 2018 | 2020 | XN Zhao, HJ Zhang, D Li, JN Zhou, YY Chen, YH Sun- PloS one, 2020 - journals.plos.org | We searched and obtained the model template ( PDB ID: 6n41 .1.A) of HA protein of A/California/07/2009. We conducted a structure prediction of the trimeric HA protein by SWISS-MODEL, then the changes at the epitopes and RBSs were visualized in PyMol |
| 340 | 4zju | - | https://onlinelibrary.wiley.com/doi/abs/10.1111/cbdd.13686 | Ternary complex formation of AFN1252 with Acinetobacter baumannii FabI and NADH: Crystallographic and biochemical studies | 2020 | NK Rao, V Nataraj, M Ravi- Chemical Biology &, 2020 - Wiley Online Library | 6AHE) with the NAD bound AbFabI ( PDB :4JZU) (243 C atoms; PDB ; 4ZJU ),showed an rms Structural superposition revealed no major conformational changes except in The crystal structure of AbFabI in the ternary complex is similar to the reported structures of EcFabI |
| 341 | 5dld | - | https://scripts.iucr.org/cgi-bin/paper?ir5017 | Structural characterization of a nonhydrolyzing UDP-GlcNAc 2-epimerase from Neisseria meningitidis serogroup A | 2020 | NK Hurlburt, J Guan, H Ong, H Yu, X Chen- Section F: Structural, 2020 - scripts.iucr.org | The 9 9 loop in NmSacA also contains a 310-helix, which is not observed in the E. coli structure . The structures of other epimerases with ligands bound in the active site, including those from Burkholderia vietnam- iensis ( PDB entry 5dld ; 48.7% identity; Seattle Structural |
| 342 | 5dd7 | - | https://repository.up.ac.za/handle/2263/77810 | Structural and inhibition studies of thiamine monosphosphate kinase from Mycobacterium tuberculosis | 2020 | LS Dlamini - 2020 - repository.up.ac.za | OT Oxythiamine PDB Protein data bank 38 Figure 3.5: Crystal structure of MtbThiL homodimer ..... 40 bind to both free enzyme and the ES complex. Detailed structural information particularly high resolution crystal structures of substrate |
| 343 | 5eks | - | https://journals.asm.org/doi/abs/10.1128/jb.00248-20 | Structural and biochemical analyses reveal that chlorogenic acid inhibits the shikimate pathway | 2020 | N Neetu, M Katiki, A Dev, S Gaur, S Tomar- Journal of, 2020 - Am Soc Microbiol | replacement method using the coordinates of chain A of DHQS enzyme from Vibrio cholerae ( PDB identifier [ID]: 3OKF Structural comparison of PaDHQS structure with its homologs closer to its homologs from A. nidulans (1SG6), V. cholerae (3OKF), A. baumannii ( 5EKS ), and H |
| 344 | 6mb1 | - | https://elifesciences.org/articles/57861 | Profiling of myristoylation in Toxoplasma gondii reveals an N-myristoylated protein important for host cell penetration | 2020 | M Broncel, C Dominicus, L Vigetti, SD Nofal, EJ Bartlett- Elife, 2020 - elifesciences.org | structure with bound IMP-1002 ( PDB : 6MB1 , [Schlott et al., 2019]) revealed high sequence identity (57%) and showed that all residues directly involved in compound binding are conserved within the TgNMT active site and therefore predicted to adopt an identical structural |
| 345 | 4xwi | - | https://www.tandfonline.com/doi/abs/10.1080/14756366.2020.1751150 | A study of Rose Bengal against a 2-keto-3-deoxy-d-manno-octulosonate cytidylyltransferase as an antibiotic candidate | 2020 | S Kim, S Jo, MS Kim, DH Shin- Journal of enzyme inhibition and, 2020 - Taylor & Francis | The atomic coordinates of the crystal structure of PaKdsB ( PDB ID: 4XWI ) were saved from the Protein Data Bank and prepared by The crystal structure of PaKdsB deposited in the Protein Data Bank was retrieved and docked with Rose Bengal to predict its binding mode |
| 346 | 6nb6 | - | https://www.nature.com/articles/s41467-020-17371-6 | Cryo-EM analysis of the post-fusion structure of the SARS-CoV spike glycoprotein | 2020 | X Fan, D Cao, L Kong, X Zhang- Nature communications, 2020 - nature.com | However, structural information of the post-fusion S2 from these highly pathogenic human-infecting The structures of pre- and post-fusion SARS-CoV S glycoprotein dramatically differ This structure suggests potential targets for the development of vaccines and therapies against |
| 347 | 6nb7 | 6nb8, 6wps, 6wpt, 6ws6 | https://www.sciencedirect.com/science/article/pii/S1471490620302118 | Structural basis of SARS-CoV-2 and SARS-CoVantibody interactions | 2020 | E Gavor, YK Choong, SY Er, H Sivaraman- Trends in, 2020 - Elsevier | While the binding of COV21 to the S-glycoprotein resembles the binding of the SARS-CoV S230( PDB : 6NB7 )[73], the binding interface SARS-CoV-2-S-S309-Fab[12] complex ( PDB : 6WPS/6WPT/6WS6) and the crystal structure of SARS |
| 348 | 5ez3 | - | https://www.mdpi.com/1422-0067/21/15/5391 | Characterization of the Proteins Involved in the DNA Repair Mechanism in M. smegmatis | 2020 | A Di Somma, C Can, A Moretta, A Cirillo- International journal of, 2020 - mdpi.com | The primary structure of the recombinant protein was verified by MALDI mapping strategy (Supplementary Materials, Table S4) and its correct folding assessed by circular The Acyl-CoA dehydrogenase from Brucella melitensis in complex with FAD ( PDB code 5EZ3 A) was |
| 349 | 6nb7 | - | https://www.preprints.org/manuscript/202005.0365 | Molecular Modelling and Docking Experiments Examining the Interaction between SARS-CoV-2 Spike Glycoprotein and Neuronal Nicotinic Acetylcholine Receptors | 2020 | K Farsalinos, E Eliopoulos, D Leonidas - 2020 - preprints.org | receptor ( PDB id: 6NB7 ) and the extracellular domain of the nAChR alpha9 subunit in complex with alpha-bungarotoxin ( PDB id: 3U8M) were downloaded from the Protein Data solved yet, we used the crystal structure of the extracellular domain of the homologous |
| 350 | 3oc6 | - | https://chemrxiv.org/ndownloader/files/23930861 | BioMetAll: Identifying Metal-Binding Sites in Proteins from Backbone Preorganization | 2020 | JE Snchez-Aparicio, L Tiessler-Sala - 2020 - chemrxiv.org | Only 6- phosphogluconolactonase from mycobacterium smegmatis (which structure is accessible at the PDB with the code 3oc6 ) with an of BioMetAll in an artificial metalloenzyme framework, we started by looking for the His-His- Asp/Glu motif in the 6-PGLac structure |
| 351 | 4twr | - | https://www.sciencedirect.com/science/article/pii/S1367593120301289 | Molecular evolution and functional divergence of UDP-hexose 4-epimerases | 2020 | S Fushinobu- Current Opinion in Chemical Biology, 2020 - Elsevier | Figure 3. Structural basis for the substrate specificity of group 1b and group 2b enzymes The rotated conformation structure was obtained using the S124A/Y149F double mutant ... Substrate-free structures of GalEs from Bacillus anthracis (BAS5114, PDB: 2C20) and Brucella abortus (PDB: 4TWR) are also available in the database |
| 352 | 6vxx | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7505244/ | Comparative molecular docking analysis of the SARS CoV-2 Spike glycoprotein with the human ACE-2 receptors and thrombin | 2020 | P Bhanu, NH Kumar, SH Kumar, M Relekar- , 2020 - ncbi.nlm.nih.gov | PDB ID, Ligand, Binding Pose, Binding Energy (Kcal/mol), RMSD, Receptor, Bond Length ( Figure 1a: Structural representation of 6VXX and thrombin, Figure 1b: Molecular interaction of with the 7th pose, Key - the sticks represents thrombin, the secondary structure represents the |
| 353 | 4x54 | - | https://onlinelibrary.wiley.com/doi/abs/10.1111/mmi.14437 | The mycolic acid reductase Rv2509 has distinct structural motifs and is essential for growth in slowgrowing mycobacteria | 2020 | A Javid, C Cooper, A Singh, S Schindler- Molecular, 2020 - Wiley Online Library | structures of the four highest-scoring experimental SDRs (3ASU/3ASV, 1XG5, 4X54 and 4BMV based on the SDR from Sphingobium yanoikuyae (4BMV. pdb ; GenBank ID ACB78183.1 structure elements of Rv2509 aligned to its corynebacterial homologues, the core structure of |
| 354 | 4q14 | - | https://researchrepository.rmit.edu.au/view/delivery/61RMIT_INST/122552998300013... | HISTIDINE PROTONATION AS A POSSIBLE MECHANISM FOR HUMAN TRANSTHYRETIN AMYLOIDOSIS: MODELLED AGAINST WALLABY | 2020 | DG D'SOUZA - 2020 - researchrepository.rmit.edu.au | 0.97 indicated a highly conserved overall structure between the solved structure of wallaby TTR and a known crystal structure of human TTR ( PDB : 3U2I). The structural homology was strong with an almost perfect overlap of their peptide backbones, secondary, tertiary and ... Table 3.3 Predicted model of human TTR compared to other structurally similar proteins 7 4Q14 Brucella 0.806 1.62 0.283 0.890 |
| 355 | 5t8s | - | https://www.biorxiv.org/content/10.1101/622068v2.full.pdf | MCSS-based Predictions of Binding Mode and Selectivity of Nucleotide Ligands | 2020 | R Gonzalez-Aleman, N Chevrollier, M Simoes- bioRxiv, 2020 - biorxiv.org | method based on a coarse-grained model (RNA-LIM) was developed to model the structure of an on the protein-nucleotide complexes currently available in the Protein Data Bank (RCSB PDB (52 less than 2.0 and thus not representative of the currently available structural data |
| 356 | 6nb8 | - | https://www.preprints.org/manuscript/202005.0270 | Use of Isoelectric Point for Fast Identification of Anti-SARS CoV-2 Coronavirus Proteins | 2020 | K Mallik - 2020 - preprints.org | If we follow the radial structure of the SARS CoV-2 virion, a gradual fall the in the pI values is 6NB8 (+) Human S230 antigen-binding fragment light chain 6.046 to make anti-viral drugs for SARS CoV-2. From the pI consideration, application of human Interferon- ( PDB ID 1AU1 |
| 357 | 6c9e | 5vpr | https://scripts.iucr.org/cgi-bin/paper?mn5126 | Structural evidence for a latch mechanism regulating access to the active site of SufS-family cysteine desulfurases | 2020 | JA Dunkle, MR Bruno, PA Frantom- Section D: Structural Biology, 2020 - scripts.iucr.org | Q5ZXX6 6c9e , A L. pneumophila Lpg0604 Resting state Page 7 Six sequences/ structures belong to the IPR010970 SufS family by sequence homology, and inspection of these structures reveals that five possess the -hairpin structure and one, PDB entry 5vpr from |
| 358 | 4qji | - | https://www.sciencedirect.com/science/article/pii/B9780128179031000097 | Natural products encompassing antituberculosis activities | 2020 | A Monga, A Sharma- Studies in Natural Products Chemistry, 2020 - Elsevier | The structure and composition of the cell envelope of M. tuberculosis are distinguished from that of other kinds of prokaryotes S. No. PDB ID, Title, Anti-TB agents 1OY0, Pantothenate kinase, 1e. 4QJI , Phosphopantothenate-cysteine ligase, Phosphopantetheine |
| 359 | 5eks | - | https://www.nature.com/articles/s41589-020-0587-9 | Architecture and functional dynamics of the pentafunctional AROM complex | 2020 | HA Veraszt, M Logotheti, R Albrecht, A Leitner- Nature Chemical, 2020 - nature.com | 2: The architecture and structural characteristics of the AROM complex. figure2. a, Definition of color scheme and order of domains in the CtAROM sequence, with gray numbers according to the succession of reactions in the pathway. b, CtAROM crystal structure with active sites ... The resulting representative PDB structures are 1NVA, 1XAL, 3QBD and 5EKS, for the DHQS |
| 360 | 4ix8 | - | https://www.sciencedirect.com/science/article/pii/S0141813020341957 | Flavones reversibly inhibit Leishmania donovani tyrosine aminotransferase by binding to the catalytic pocket: An integrated in silico-in vitro approach | 2020 | S Sasidharan, P Saudagar- International Journal of Biological, 2020 - Elsevier | TAT has also been characterized in Leishmania major [26], Leishmania donovani [10], and Leishmania infantum [8]. Furthermore, the crystal structure of the TAT from L. infantum has been solved ( PDB id: 4IX8 ) [27] and the structure contained PLP in the active site cavity bound |
| 361 | 6vxx | 6vyb | https://www.researchsquare.com/article/rs-30938/latest.pdf | Phytocompounds of Rheum emodi, Thymus serpyllum and Artemisia annua inhibit COVID-19 binding to ACE2 receptor: In silico approach | 2020 | R Rolta, D Salaria, V Kumar, A SOURIRAJAN, K DEV - 2020 - researchsquare.com | proteins of COVID-19 were SARS-CoV-2 spike glycoprotein ( PDB ID: 6VXX ) and SARS-CoV-2 spike ectodomain structure ( PDB ID: 6VYB) and SARS coronavirus spike receptor-binding domain was Structural Bioinformatics Group, Berlin, Germany) for ADMET |
| 362 | 5vir | 4fry, 4ymi | https://pubs.acs.org/doi/abs/10.1021/acsinfecdis.0c00735 | Structural and Molecular Dynamics of Mycobacterium tuberculosis Malic Enzyme, a Potential Anti-TB Drug Target | 2020 | KH Burley, BJ Cuthbert, P Basu- ACS Infectious, 2020 - ACS Publications | \ Interestingly, the three top-scoring NADP+ molecules are found in structures of Mtb nicotinamide-mononucleotide adenylyltransferase (NadD) (PDB ID: 4S1O) and Mycobacterium abscessus NadD (PDB ID: 4YMI and 5VIR). These results |
| 363 | 6od8 | - | https://www.sciencedirect.com/science/article/pii/S0141813020347772 | Leishmanial aspartyl-tRNA synthetase: Biochemical, biophysical and structural insights | 2020 | GC Panigrahi, R Qureshi, P Jakkula, KA Kumar- International Journal of, 2020 - Elsevier | Furthermore, CD and intrinsic tryptophan fluorescence measurements showed the changes in structural conformation at varying pH, denaturants and ligands. The modelled LdaspRS structure presented all the specific characteristics of class II aaRSs, ... The three-dimensional structure of LdaspRS was predicted by homology modelling using Modeller 9.16 [22] with Leishmania major Friedlin aspartyl tRNA synthetase (PDB ID: 6OD8) as a template. |
| 364 | 4f2n | - | https://www.mdpi.com/2223-7747/9/8/983 | Three Alkaloids from an Apocynaceae Species, Aspidosperma spruceanum as Antileishmaniasis Agents by In Silico Demo-case Studies | 2020 | D Morales-Jadn, J Blanco-Salas, T Ruiz-Tllez- Plants, 2020 - mdpi.com | of this method can provide insights into the druggable targetome contained in the structural proteome criteria were chosen (vg to be a starting structure , to have a similar structure of a drawn using Marvin Sketch 19.15 converting the format of some structures into pdb files using ... Table A2. Enzymes crystal structures available in PDB server. 4f2n.1.A target SOD |
| 365 | 5vvw | - | https://www.sciencedirect.com/science/article/pii/S0024320520312194 | Comparative modeling and dynamic simulation of UDP-N-acetylmuramoyl-alanine ligase (MurC) from Mycobacterium tuberculosis through virtual screening | 2020 | MA Isa- Life Sciences, 2020 - Elsevier | The reference sequence (query sequence), searched against PDB and six proteins (1GQQ, 4HV4, 1P31, 2F00, 5VVW and 1J6U of its entire amino acids were in the most favorable region(Table 1). The G-factor of both the model of MurC, minimized model structure and the |
| 366 | 6ok4 | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/pro.3975 | Chlamydia trachomatis glyceraldehyde 3phosphate dehydrogenase: Enzyme kinetics, highresolution crystal structure, and plasminogen binding | 2020 | N Schormann, J Campos, R Motamed- Protein, 2020 - Wiley Online Library | Chlamydia trachomatis glyceraldehyde 3phosphate dehydrogenase: Enzyme kinetics, highresolution crystal structure , and plasminogen binding. Norbert Schormann We describe here the highresolution crystal structure of the holo enzyme refined at 1.5 resolution |
| 367 | 6nb6 | 6nb7 | https://www.researchsquare.com/article/rs-33181/latest.pdf | Computational approach for the design of potential spike protein binding natural compounds in SARS-CoV2 | 2020 | A Basu, A Sarkar, U Maulik - 2020 - researchsquare.com | 2dd8:S, 2ghw:A, 1q4z:A, 1t7g:A, 1xjp:A, 5xlr:A, 5x58:A, 6nb6 :A, 6nb7 ASN 448 are also conserved in ve SARS CoV-2 spike protein PDB structures and changed in SARS-CoV 21. Guex, N., Peitsch, MC, Schwede, T. Automated comparative protein structure modeling with SWISS |
| 368 | 4f82 | 4f4a | http://search.proquest.com/openview/afda5488243a36c7973c912298122359/1?pq-origsi... | Investigating Imatinib-Resistant Mutations in Abl Kinase | 2020 | A Lyczek - 2020 - search.proquest.com | 10 *(52& Illustration of important structural features of imatini< |
| 369 | 4ot8 | - | https://pubs.acs.org/doi/abs/10.1021/acschembio.0c00753 | l-Threonine Transaldolase Activity Is Enabled by a Persistent Catalytic Intermediate | 2020 | P Kumar, A Meza, JM Ellis, GA Carlson- ACS Chemical, 2020 - ACS Publications | l-Threonine transaldolases (lTTAs) are a poorly characterized class of pyridoxal-5-phosphate (PLP) dependent enzymes responsible for the biosynthesis of diverse -hydroxy amino acids... The structure was solved by molecular replacement with a distantly related serine hydroxymethyltransferase (PDB ID: 4OT8, 28.2% identity |
| 370 | 4q04 | - | https://link.springer.com/article/10.1007/s12551-020-00766-6 | Structural and functional diversity of Entamoeba histolytica calcium-binding proteins | 2020 | S Kumar, S Mishra, S Gourinath- Biophysical Reviews, 2020 - Springer | 78% identical). Here, along with the reported structures of amoebic CaBP1, CaBP2, CaBP3, and CaBP5, we have complied the structural information of an unpublished structure of EhCaBP19 ( PDB deposited) as well. In this |
| 371 | 4lsm | 6ok4, 4k9d | https://tede2.uepg.br/jspui/handle/prefix/3244 | Estudos estruturais das enzimas urocanato hidratase de Trypanosoma cruzi, gliceraldedo-3-fosfato desidrogenase de Schistosoma mansoni e glicose-6-fosfato-1 | 2020 | S Boreiko - 2020 - tede2.uepg.br | the conformation of monomers A and C, which were explored to understand structural changes in 1-Epimerase, also part of the glycolytic pathway, had its structure modeled by e Homo sapiens 2 (cdigo PDB 3H9E), Trypanosoma cruzi (cdigo PDB 4LSM ), Arabidopsis thaliana |
| 372 | 3r20 | 3r8c | https://link.springer.com/article/10.1007/s13721-019-0191-7 | Homology modeling and in silico toxicity assessment of potential inhibitors of cytidylate kinase from Mycobacterium tuberculosis | 2019 | MA Isa- Network Modeling Analysis in Health Informatics and, 2019 - Springer | Six templates ( PDB CODE: 3R20 , 3R8C, 1Q3T, 1CKE, 2CMK, and 4E22) were selected based on the An alignment of the CMK and the 3R20 revealed that their structures share a 74.0 Ten structural models of CMK were generated, and the structure with the least DOPE and fold |
| 373 | 6bfu | - | https://link.springer.com/article/10.1186/s12859-019-3097-6 | Glycosylator: a Python framework for the rapid modeling of glycans | 2019 | T Lemmin, C Soto- BMC bioinformatics, 2019 - Springer | 1 ha0. 5fyl (gp120). 6bfu . Number of sequons. 6 A second N-Acetyl-D-Glucosamine will then be linked through a 1-4 glycosidic bond. Finally, an Alpha-D-Mannosewill be built ab initio and saved to a PDB file The structure of a mannose 9 will be imported as a Molecule instance |
| 374 | 3rr2 | 3hwi | http://repositorio.unicamp.br/handle/REPOSIP/335172 | Caracterizao da via de captura/assimilao de sulfato em Mycobacterium tuberculosis: estratgias para o desenvolvimento de inibidores e potenciais alvos para | 2019 | AN Cerone - 2019 - repositorio.unicamp.br | transport of several substances essential to the survival of organisms, which are poorly characterized in M. tuberculosis, the elucidation of structures and molecular SubI was expressed and purified and had its three-dimensional structure solved in the |
| 375 | 6c9c | - | https://www.biorxiv.org/content/10.1101/863571v1.abstract | Disorder and interfaces in proteins are two sides of the same coin | 2019 | B Seoane, A Carbone- bioRxiv, 2019 - biorxiv.org | c. Analysis of cluster 6c9c A ( PDB IDs for the structures are given in SI section S2). In the external wheel, we show one unbound structure and the chain structures containing the 12 different interfaces of this cluster: DRs in orange and IRs in blue |
| 376 | 5td3 | - | https://www.jstage.jst.go.jp/article/jgam/advpub/0/advpub_2019.06.002/_article/-... | Cloning, expression and characterization of catechol 1, 2-dioxygenase from Burkholderia cepacia | 2019 | TVN Thi, DDH Sinh, THT Le, ND Huy- The Journal of general, 2019 - jstage.jst.go.jp | Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: 337 quantitative structure /activity relationship and the crystal structures of native enzyme 338 radioresistens LMG S13 ( PDB : 2XSU), B. vietnamiensis LMG 22486 ( PDB : 5TD3 ), R. 375 |
| 377 | 5b8i | - | https://www.biorxiv.org/content/10.1101/813717v1.abstract | Biochemical, Biophysical, and Functional Analyses of Two Isoforms of the SnRK2 inhibitor AtSCS | 2019 | K Tarnowski, M Klimecka, A Ciesielski, G Goch, A Kulik- bioRxiv, 2019 - biorxiv.org | 5a, 02-106 Warsaw, Poland 20 2 Warsaw University, Department of Chemistry, Pasteura 1, 02-093 Warsaw, Poland 21 3 The Norwegian Center for Structure Biology, Institute of Chemistry, University of 22 Functional and structural studies showed that PP2Cs 110 |
| 378 | 3nfw | - | https://pubs.rsc.org/doi/c9se00523d | The oxygen reduction reaction catalyzed by Synechocystis sp. PCC 6803 flavodiiron proteins | 2019 | KA Brown, Z Guo, M Tokmina-Lukaszewska- Sustainable Energy &, 2019 - pubs.rsc.org | 3, 12 and 13) and provide more insights into the Flv structure , substrate reactivity and protein based on heuristics to maximize confidence, percentage identity and alignment coverage ( PDB IDs: 1VME for the oxidoreductase domain: 5ZC2, 55 3RH7, 4HX6, 56 3K87, 57 3NFW 58 |
| 379 | 3tmg | - | https://www.frontiersin.org/articles/10.3389/fmicb.2019.02572/full?report=reader | Examination of the Glycine Betaine-Dependent Methylotrophic Methanogenesis Pathway: Insights Into Anaerobic Quaternary Amine Methylotrophy | 2019 | AJ Creighbaum, T Ticak, S Shinde, X Wang- Frontiers in, 2019 - frontiersin.org | We therefore generated models of MV8460 using the apo-crystal structure of DhMtgB ( PDB 2QNE) as a (A) The models represent the aligned global structure of DhMtgB Various crystal structures of GB-binding enzymes; 1R9L (Schiefner et al., 2004), 6EYG, 3TMG (Li et al |
| 380 | 4xfd | - | https://www.tandfonline.com/doi/abs/10.1080/07391102.2018.1552199 | Validation of NAD synthase inhibitors for inhibiting the cell viability of Leishmania donovani: In silico and in vitro approach | 2019 | H Mandal, S Vijayakumar, S Yadav- Structure and, 2019 - Taylor & Francis | Skip to Main Content |
| 381 | 4qtp | - | https://www.biorxiv.org/content/10.1101/674879v1.abstract | SiaABCDA threonine phosphorylation pathway that controls biofilm formation in Pseudomonas aeruginosa | 2019 | WH Poh, J Lin, B Colley, N Mller, BC Goh- BioRxiv, 2019 - biorxiv.org | 7NTU Institute of Structural Biology, Nanyang Technological University, Singapore 18 Biofilms are ubiquitous, multicellular structures embedded in a self-made matrix, that can suspended biofilms greatly influence the development, structure and function of their surface-attached |
| 382 | 6bfu | - | https://www.sciencedirect.com/science/article/pii/S1879625719300392 | Glycosylation of viral surface proteins probed by mass spectrometry | 2019 | AA Hargett, MB Renfrow- Current opinion in virology, 2019 - Elsevier | spike GP has 26 NGS with 15 in subunit 1 and 11 in subunit 2 ( PDB : 6BFU ) [89]. (e) Influenza virus hemagglutinin is a homotrimer with 11 NGS ( PDB : 4FNK) [92] can be coupled with other biological data to better understand the role of glycosylation in the structure and function |
| 383 | 3sbx | - | https://www.nature.com/articles/s41598-019-53171-9 | A LONELY GUY protein of Bordetella pertussis with unique features is related to oxidative stress | 2019 | F Moramarco, A Pezzicoli, L Salvini, R Leuzzi- Scientific reports, 2019 - nature.com | first resorted to a theoretical approach. This involved overlapping a model of BP1253 with a monomer of the type-I LOG protein of M. marinum co-crystallized with AMP (MmLOG, PDB 3SBX ) 14,19 . BP1253 was modeled on a |
| 384 | 4hwg | - | https://www.biorxiv.org/content/10.1101/535138v1.abstract | Energy Landscape of the Domain Movement in Staphylococcus aureus UDP-N-acetylglucosamine 2-epimerase | 2019 | C de Azevedo, AS Nascimento- bioRxiv, 2019 - biorxiv.org | chain without ligands PDB ID Organism Ligands Oligomeric state CV Angle Chain A (deg) Rickettsia bellii ( 4HWG ). We hypothesize that the cubic symmetry observed in this crystal (UDP-GlcNac) and cofactor (UDP) are found bound in the crystal structure (1VGV, 3BEO, 4FKZ |
| 385 | 3qhx | - | https://www.biorxiv.org/content/10.1101/651067v1.abstract | SolXplain: An Explainable Sequence-Based Protein Solubility Predictor | 2019 | R Mall- bioRxiv, 2019 - biorxiv.org | be used as a scoring function to measure the quality of a tree structure Ht at in [13], devise a fast, greedy and iterative algorithm to identify these optimal tree structures We train our XGBoost classifier on top of physio-chemical (global), sequence and structural features extracted |
| 386 | 5cy4 | - | https://www.tandfonline.com/doi/abs/10.1080/07391102.2019.1643786 | Structural and dynamic studies provide insights into specificity and allosteric regulation of ribonuclease as, a key enzyme in mycobacterial virulence | 2019 | L Calvanese, F Squeglia, M Romano- Structure and, 2019 - Taylor & Francis | Despite this, its structure , a dimeric molecule with each monomer adopting a compact entry 4OKE) from Mycobacterium tuberculosis against the Protein Data Bank ( PDB ) using the Coxiella burnetii (Coxbu) (3TR8, Z-score 13.8), Acinetobacter baumannii (Aciba) ( 5CY4 , Z-score |
| 387 | 4npc | - | https://www.ingentaconnect.com/contentone/govi/pharmaz/2019/00000074/00000002/ar... | Synthesis and antibacterial activity of novel icariin derivatives | 2019 | A Wang, Y Xu- Die Pharmazie-An International Journal of, 2019 - ingentaconnect.com | The X-ray structure of MetAP1 ( PDB : 4npc ) was also obtained from Protein Databank ( PDB ). Before going to the docking procedure, the protein structure was prepared using the Protein preparation wizard of the DS 2017 R2 |
| 388 | 4lgv | - | https://www.mdpi.com/1422-0067/20/21/5279 | Molecular Cloning and Exploration of the Biochemical and Functional Analysis of Recombinant Glucose-6-Phosphate Dehydrogenase from Gluconoacetobacter | 2019 | EJ Ramrez-Nava, D Ortega-Cuellar- International journal of, 2019 - mdpi.com | Keywords: glucose 6 phosphate dehydrogenase (G6PD); bioinformatics analysis; kinetic parameters; thermal stability; three-dimensional structure Finally, using homologous 3D structures , we modeled the G6PD protein, which suggests the structural and functional |
| 389 | 4gie | - | https://www.mdpi.com/1422-0067/20/23/5916 | Trypanocidal Mechanism of Action and in silico Studies of p-Coumaric Acid Derivatives | 2019 | SP Lopes, YP Castillo, ML Monteiro- International journal of, 2019 - mdpi.com | In this work, twelve compounds were prepared, maintaining the (E)-3-(4-hydroxyphenyl) acrylic acid structure and modifying only the radical R for 7, C-8, C-9), being six from the aromatic ring and three from the side chain with the presence of carbonyl that confirms the structures |
| 390 | 3p96 | - | https://www.mdpi.com/1424-8247/12/2/66 | Targeting the Serine Pathway: A Promising Approach against Tuberculosis? | 2019 | M Haufroid, J Wouters- Pharmaceuticals, 2019 - mdpi.com | Structural differences can occur from one specie to another, ie, human phosphoserine phosphatase is only composed of the PSP domain while of the pathway in order to inhibit the reaction in an allosteric manner (Figure 7b).... Structure of M. avium (3P96) with domain ACT-I in orange, ACT-II in blue, the linker between two ACT domains in red, PSP catalytic domain in grey, linker between PSP domain and ACT-II in green (b). ... |
| 391 | 4xgi | - | https://link.springer.com/content/pdf/10.1007/s10989-019-09886-4.pdf | Homology Modeling and Molecular Docking Studies of Glutamate Dehydrogenase (GDH) from Cyanobacterium Synechocystis sp. PCC 6803 | 2019 | O Haghighi, S Davaeifar, HS Zahiri, H Maleki- International Journal of, 2019 - Springer | aLigand name in structure : NAD-507 Docking pose number Reference ligand in crystallography structure (ligand name and pdb code) NADH NADPH AKG Glutamate 1V9L 1HWYa 5GUD 5IJZ 1HWY 4XGI 6DHM 3AOG Pose 01 4.57 3.48 5.74 5.75 2.22 2.11 1.72 1.58 |
| 392 | 5cy4 | - | https://febs.onlinelibrary.wiley.com/doi/abs/10.1002/2211-5463.12720 | Characterization of an intertidal zone metagenome oligoribonuclease and the role of the intermolecular disulfide bond for homodimer formation and nuclease activity | 2019 | Y Piotrowski, K Berg, DP Klebl, I Leiros- FEBS open, 2019 - Wiley Online Library | campestris, PDB 1J9A: Haemophilus influenzae, PDB 2IGI: E. coli, PDB 3TR8: Coxiella burnetii, PDB 5CY4 : Acinetobacter baumannii) In the X. campestris Orn structure ( PDB 2GBZ) it is shown that Orn forms a dimer in the crystal From the structural analysis it was shown that |
| 393 | 5cy4 | - | https://www.nature.com/articles/s41598-019-39641-0 | Structural basis of small RNA hydrolysis by oligoribonuclease (Cps ORN) from Colwellia psychrerythraea strain 34H | 2019 | CW Lee, SH Park, CS Jeong, SS Cha, H Park- Scientific reports, 2019 - nature.com | Structure alignment search using DALI server showed that CpsORN exhibited high structural similarity with ORN HinORN; PDB code 1J9A), and Acinetobacter baumannii (AbaORN; PDB code 5CY4 ), and XC847 from Xanthomonas campestris (XcaORN; PDB code 2GBZ |
| 394 | 5dvw | - | http://journal.umpalangkaraya.ac.id/index.php/bjop/article/view/836 | Computational Drug Design against Ebola Virus Targeting Viral Matrix Protein VP30 | 2019 | A Venkatesan, L Ravichandran- Borneo Journal of, 2019 - journal.umpalangkaraya.ac.id | Protein structure preparation The protein crystal structure of Ebola VP30 protein ( PDB code: 5DVW ) with the resolution of 1.75 was retrieved from RCSB Protein Data Bank ( PDB ), a repository providing crystal structures of biotic macromolecules (Berman et al., 2000) |
| 395 | 5eqz | - | https://www.nature.com/articles/s41598-019-53830-x | Membrane directed expression in Escherichia coli of BBA57 and other virulence factors from the Lyme disease agent Borrelia burgdorferi | 2019 | KE Robertson, CD Truong, FM Craciunescu, PL Chiu- Scientific reports, 2019 - nature.com | All available structures from the genus Borrelia represent proteins expressed without a membrane Towards elucidating structure and function of these critical proteins, we directed translocation of to the outer membrane, Another criterion was the lack of structures in the PDB. RevA has a structure in the PDB33, a 1.80 Å crystal structure (accession no. 5EQZ, unpublished [J.K. Yano, A.H. Sullivan, J. Abendroth, D.D. Lorimer, and T.E. Edwards]), which is of the soluble domain that was expressed in the c |
| 396 | 5el0 | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/prot.25869 | An overview of data-driven HADDOCK strategies in CAPRI rounds 38-45. | 2019 | PI Koukos, J Roel-Touris, F Ambrosetti, C Geng- bioRxiv, 2019 - biorxiv.org | For the server submission of target 134, we modelled the protein on PDB entry 4d07 and the peptide on 4d07 and 4qh8, threading the target sequence on the peptide structure of the templates 5el0 and followed similar strategies as for target 134. Template-based targets |
| 397 | 4xk1 | - | https://www.sciencedirect.com/science/article/pii/S014181301930755X | N-terminal residues are crucial for quaternary structure and active site conformation for the phosphoserine aminotransferase from enteric human parasite E. histolytica | 2019 | RK Singh, P Tomar, S Dharawat, S Kumar- International journal of, 2019 - Elsevier | 3. Comparative analysis, using the RAPIDO server, of PSAT structures from various organisms with the EhPSAT structure . PDB IDs, Sequence identity (%), RMSD with EhPSAT monomer in (number of residues compared) 4XK1 (P. aeruginosa) [38], 40, 1.52 (for 337 residues) |
| 398 | 4pfz | - | https://www.sciencedirect.com/science/article/pii/S0006291X19308988 | Structural insights into a maleylpyruvate hydrolase from sphingobium sp. SYK-6, a bacterium degrading lignin-derived aryls | 2019 | H Hong, H Seo, KJ Kim- Biochemical and biophysical research, 2019 - Elsevier | delta-isomerase from Mycobacterium smegmatis strain ATCC 700084 ( PDB code 4PFZ , 41% sequence The model building and structure refinement were performed as in SsMPH Apo type Mn 2+ -pyruvate have been deposited in the Protein Data Bank with PDB codes 6JVV |
| 399 | 4qhq | - | https://scripts.iucr.org/cgi-bin/paper?tb5146 | Structural insights into the substrate specificity of SP_0149, the substrate-binding protein of a methionine ABC transporter from Streptococcus pneumoniae | 2019 | B Jha, R Vyas, J Bhushan, D Sehgal- Section F: Structural, 2019 - scripts.iucr.org | Z-score Rmsd (A ) Nalign %seq} Bound substrate PDB code Protein name and description 15.2 1.36 223 41 Met 4qhq A nutrient-binding protein (bound to methionine in the Sequence identity in SSM is calculated from structure (three-dimensional), rather than sequence |
| 400 | 4qhq | - | https://link.springer.com/protocol/10.1007/978-1-4939-8736-8_12 | Navigating Among Known Structures in Protein Space | 2019 | A Narunsky, N Ben-Tal, R Kolodny- Computational Methods in Protein, 2019 - Springer | evolutionary history, with sequences that diverged beyond the point where one can identify their common ancestry; for example, the SCOP fold, CATH Architecture , and ECOD As both neighbors ( pdb 4qhq and pdb 3qwl) have a bound methionine in their PDB structure (Fig |
| 401 | 4qji | - | https://www.sciencedirect.com/science/article/pii/S0022283618311392 | Crystallographic Analysis of the Catalytic Mechanism of Phosphopantothenoylcysteine Synthetase from Saccharomyces cerevisiae | 2019 | P Zheng, M Zhang, MH Khan, H Liu, Y Jin, J Yue- Journal of molecular, 2019 - Elsevier | 4a, b) [14], [15]. Overall structure of the enzymes represent tightly binding dimers linked by dimerization domains which are comprised of three regions as shown in Fig. S4 A divalent metal ion (Ca 2+ in E. coli; Mg 2+ in M. smegmatis. PDB ID: 1U7W; 4QJI ) is coordinated |
| 402 | 4ix8 | - | https://febs.onlinelibrary.wiley.com/doi/abs/10.1002/2211-5463.12715 | Biochemical and structural characterization of tyrosine aminotransferase suggests broad substrate specificity and a two state folding mechanism in Leishmania | 2019 | S Sasidharan, P Saudagar- FEBS Open Bio, 2019 - Wiley Online Library | outlier region. PROSA score of PM0081305 was -8.56 and the score remained in the region of known native structures . The template structure that was taken for modeling ( PDB ID: 4IX8 ) had a PROSA score of -8.89. The structure |
| 403 | 6nb7 | 6nb4 | https://jvi.asm.org/content/early/2019/12/05/JVI.02015-19.abstract | Molecular mechanism for antibody-dependent enhancement of coronavirus entry | 2019 | Y Wan, J Shang, S Sun, W Tai, J Chen, Q Geng- Journal of, 2019 - Am Soc Microbiol | change of the spike. Future study on the high-resolution cryo-EM structure of MERS- 230 CoV Se trimer complexed with Mersmab1 will be needed to provide detailed structural 231 information for the Mersmab1-triggered conformational changes of MERS-CoV Se. SARS-CoV S-e complexed with S230 mAb (PDB ID: 6NB7). |
| 404 | 4dhe | 6n38 | https://www.annualreviews.org/doi/abs/10.1146/annurev-micro-020518-115420 | Assembly and subcellular localization of bacterial type VI secretion systems | 2019 | J Wang, M Brodmann, M Basler- Annual review of microbiology, 2019 - annualreviews.org | The TssM cytosolic domain is modeled after NTPase-like domain EngB ( PDB 4DHE ) followed by a helical extension modeled after DPY-30 f ) Structure of the PDB 3ZRJ) binding to the TssC positioned in the same orientation as in panel e. Abbreviation: PDB , PDB , Protein Data |
| 405 | 4yk1 | 4yk2, 4yk3 | https://www.frontiersin.org/articles/10.3389/fmicb.2019.00921/abstract | Versatility of the BID domain: Conserved function as type-IV-secretion-signal and secondarily evolved effector functions within Bartonella-infected host cells | 2019 | A Wagner, C Tittes, C Dehio- Frontiers in microbiology, 2019 - frontiersin.org | BID fold is highlighted through superposition of the three solved BID domains: BroBep6_tBID1 (green; PDB : 4YK1 ), BclBep9_tBID1 (cyan; PDB : 4YK2), and BheBepE_BID1 (purple; PDB : 4YK3 into ancestral tBIDs found in the canonical FIC-OB-BID architecture and derived |
| 406 | 6d8w | 6n41 | https://www.tandfonline.com/doi/abs/10.1080/21645515.2019.1653743 | Computationally optimized broadly reactive vaccine based upon swine H1N1 influenza hemagglutinin sequences protects against both swine and human isolated | 2019 | AL Skarlupka, SO Owino- Human vaccines &, 2019 - Taylor & Francis | The known crystal structure were used for A/California/07/2009 ( PDB accession: 3lzg23) and A/Swine/Indiana/P12439/2000 templates were chosen for model building.29 The crystal struc- tures of A/Jiangsu/ALSI/2011 (H1N1) HA ( PDB accession: 6d8w ) was selected |
| 407 | 4wbs | - | https://scripts.iucr.org/cgi-bin/paper?ft5098 | The structure of lipopolysaccharide transport protein B (LptB) from Burkholderia pseudomallei | 2019 | G Pankov, A Dawson, WN Hunter- Section F: Structural Biology, 2019 - scripts.iucr.org | A single polypeptide from Paraburkholderia phymatum LptB ( PDB entry 4wbs ; Seattle Structural Genomics Center 2. The LptB subunit fold is conserved and displays no major conformational differences irrespective of whether the cofactor is present in the structure or not |
| 408 | 4tv4 | - | https://www.sciencedirect.com/science/article/pii/S0092867419302028 | Cryo-EM Structure and Assembly of an Extracellular Contractile Injection System | 2019 | F Jiang, N Li, X Wang, J Cheng, Y Huang, Y Yang- Cell, 2019 - Elsevier | Overall, the PVC particle displays a simplified structure of the bacterial phage A simplified architecture of T4 phage baseplate lies in the PVC syringe: Pvc5, Pvc7, Pvc8, and Pvc10 form a continuous central spike extending from the inner tube; Pvc11 (D) Initial models of Pvc1, Pvc2, Pvc9 and Pvc11 were built based onPDB: 4TV4, 3J9Q, 2IA7, 5HX2, respectively |
| 409 | 5k85 | - | https://www.sciencedirect.com/science/article/pii/S0022283619303092 | Structures of 2-Hydroxyisobutyric Acid-CoA Ligase Reveal Determinants of Substrate Specificity and Describe a Multi-Conformational Catalytic Cycle | 2019 | M Zahn, N Kurteva-Yaneva, J Schuster, U Krug- Journal of molecular, 2019 - Elsevier | The substrate specificity of HCL corresponds well to the adenylate-forming active-site architecture ... This is in contrast to other ANL ligase structures, where the CoA or acyl-CoA molecules adopt more stretched conformations, for example, in the thioester-forming conformations of bacterial [38] and fungal acetyl-CoA synthetase (PDB ID: 5K85), |
| 410 | 5deo | - | https://pubs.acs.org/doi/abs/10.1021/acschembio.9b00124 | Novel antimycobacterial compounds suppress NAD biogenesis by targeting a unique pocket of NaMN adenylyltransferase | 2019 | AL Osterman, I Rodionova, X Li, E Sergienko- ACS chemical, 2019 - ACS Publications | ADVERTISEMENT. Log In Register. Cart. ACS; ACS Publications; C&EN; CAS. ACS Publications: ACS Journals; ACS eBooks; C&EN Global Enterprise. A; Accounts of Chemical Research; ACS Applied Bio Materials; ACS Applied Electronic |
| 411 | 4odj | - | https://scripts.iucr.org/cgi-bin/paper?no5145 | Structure of a critical metabolic enzyme: S-adenosylmethionine synthetase from Cryptosporidium parvum | 2019 | J Ohren, GF Parungao, RE Viola- Section F: Structural Biology, 2019 - scripts.iucr.org | Vagin & Teplyakov, 2010) with the structure of C. hominus MetK ( PDB entry 4odj ) as the ordered in the presence of substrates, is disordered and was not modeled in this structure to form functional tetramers with D2 or 222 symmetry, as illustrated by EcoMetK ( PDB entry 1p7l |
| 412 | 3pk0 | 3rih | http://atrium.lib.uoguelph.ca/xmlui/handle/10214/16112 | Structural and functional characterization of the aminoacetone utilization microcompartment from Mycobacterium smegmatis MC2 155 | 2019 | E Mallette - 2019 - atrium.lib.uoguelph.ca | P)(H) - nicotninamide adenine dinucleotide (phosphate)(reduced) NTP - nucleotide triphosphate PDB - protein data bank (protein structure archive) PDU 1.2.1 Superstructure Architecture Microcompartments were first visualized in electron micrographs of carboxysome |
| 413 | 5j92 | - | https://sfamjournals.onlinelibrary.wiley.com/doi/abs/10.1111/1462-2920.14847 | Preferential catabolism of the (S)enantiomer of the herbicide napropamide mediated by the enantioselective amidohydrolase SnaH and the dioxygenase Snpd in | 2019 | J Huang, D Chen, J Jiang- Environmental microbiology, 2019 - Wiley Online Library | molecular docking. A homology model of Snpd was built based on chain A of the 5J92 template (sharing 39% identity with Snpd; PDB code; resolution: 1.95 ). A Snpd- KG-FeO complex structure was established in a similar manner as SnaH-Zn-H2O. The |
| 414 | 3tde | 5t8s, 3iml | https://www.sciencedirect.com/science/article/pii/S0022283619305480 | The interdimeric interface controls function and stability of Ureaplasma urealiticum methionine S-adenosyltransferase | 2019 | D Kleiner, F Shmulevich, R Zarivach, A Shahar- Journal of molecular, 2019 - Elsevier | MAT ( PDB ID), Phylum/class, Monomer length b, % sequence identity to E. coli, Interface c, M. tuberculosis ( 3TDE ), Actinobacteria/actinobacteria, 403, 59%, large, 11.5, 1983, 23, 11 1). In addition, the flexible loops (positions 89116) fully discernible in this structure were found |
| 415 | 5u2w | - | https://www.sciencedirect.com/science/article/pii/S0022283619303675 | Structure-Guided Generation of a Redox-Independent Blue Fluorescent Protein from mBFP | 2019 | PW Seo, ES Jo, SH You, DE Cheong, GJ Kim- Journal of molecular, 2019 - Elsevier | Structure -guided mutagenesis confirmed the residues' role in the fluorescent capacity of mBFP Moreover, we identified another SDR family protein ( PDB ID 5u2w ) from Burkholderia cenocepacia J2315 (BFPbc) with blue fluorescent capacity in the presence of NADPH, which |
| 416 | 6auj | 3gwc, 3ix6 | https://www.mdpi.com/1420-3049/24/8/1638 | Targeting Methyltransferases in Human Pathogenic Bacteria: Insights into Thymidylate Synthase (TS) and Flavin-Dependent TS (FDTS) | 2019 | C Pozzi, L Lopresti, G Tassone, S Mangani- Molecules, 2019 - mdpi.com | This review is aimed to summarize the current understanding of structure and function of bTSs and FDTSs and the recent id 1F4B [17]), Brucella melitensis (BmTS; PDB id 3IX6, unpublished research), and Elizabethkingia anophelis (EaTS; PDB id 6AUJ , unpublished research |
| 417 | 3ido | 3jvi | https://www.sciencedirect.com/science/article/pii/S1570963918302012 | Vibrio cholerae LMWPTP-2 display unique surface charge and grooves around the active site: Indicative of distinctive substrate specificity and scope to design specific | 2019 | S Chatterjee, S Nath, B Ghosh, U Sen- Biochimica et Biophysica Acta (BBA, 2019 - Elsevier | The surface properties of VcLMWTP-1, although have some distinct features, resembles closely to that of E. histolytica LMWPTP ( PDB : 3IDO ) This closure at the P-loop is also evident from the structural alignment with an 'open structure ' of apo-MPtpA ( PDB : 2LUO) [41] to the |
| 418 | 2kok | 2mu0 | https://link.springer.com/article/10.1007/s00894-018-3885-3 | Structure and function prediction of arsenate reductase from Deinococcus indicus DR1 | 2019 | D Chauhan, PA Srivastava, V Agnihotri- Journal of molecular, 2019 - Springer | Model1 of ArsC with 3RDW is 1.5 , 1I9D is 2.2 , 1J9B is 2.2 , 2KOK is 3.0 In the case of ArsC, the ArsC C12S mutant ( PDB ID: 1S3C) from E. coli was used as the a confidence score of 0.9040, indicating a very high quality model, where an accurate modeled structure has a |
| 419 | 3o0m | 3r6f, 3oj7, 3lb5 | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6354057/ | Crystal Structure of Histidine Triad Nucleotide-Binding Protein from the Pathogenic Fungus Candida albicans | 2019 | A Jung, JS Yun, S Kim, SR Kim, M Shin- Molecules and, 2019 - ncbi.nlm.nih.gov | 3. The most similar structure was HINT from the protozoal species Leishmania major (LmHINT); the Z-score was 18.8, and the rmsd Species b, C-terminal region, Z-score, RMSD (), Identity (%), C, PDB code, NCBI ID M. smegmatis, II, 14.9, 3.6, 29, 110, 3O0M , WP_011730267.1 |
| 420 | 3i4e | 3eol, 3p0x, 3e5b, 3oq8 | https://ubir.buffalo.edu/xmlui/handle/10477/79369 | Mechanistic Insights into the Catalytic Mechanism and Inhibition of Mycobacterium Tuberculosis Isocitrate Lyase | 2019 | S Ray - 2019 - ubir.buffalo.edu | an attractive target for drug development. 1.4.3 Structure of ICL Aspergillus nidulans [ PDB ID: 1DQU],67 M. tuberculosis [ PDB ID: 1F61, 1F8I, 1F8M, 5DQL],68- 69 Escherichia coli [ PDB ID:1IGW]70, Burkholderia pseudomallei [ PDB ID: 3I4E (paper |
| 421 | 4f40 | 4h51, 4h7p | https://www.preprints.org/manuscript/201902.0122 | Leishmania Proteomics: An in Silico Perspective | 2019 | CA Padilla, MJ Alvarez, A Combariza - 2019 - preprints.org | PDB -codes but same structure and proteins with equal structures but elucidated from dif thase from L. major (PGF; PDB ID: 4F40 ) is involved in the lipid metabolic pathway, acting FPPS protein ( PDB ID: 4JZX) is potently inhibited by bisphosphonates in the trypanosomatid |
| 422 | 2n6t | 2n6x, 2n6w, 2n6s | https://www.biorxiv.org/content/10.1101/554931v1.abstract | Conditional Prediction of RNA Secondary Structure Using NMR Chemical Shifts | 2019 | K Zhang, AT Frank- bioRxiv, 2019 - biorxiv.org | chemical shifts were downloaded from the Protein Data Bank ( PDB : http://www. pdb .org) and native NMR-derived structure and the comparison structure is the CS-Folding generated structure 2JYM 2L5Z 2LK3 2MIS 2QH2 1Z2J 1JO7 5UZT 2N3Q 5IEM 2L3E 2N6T 2LPS 2N6S |
| 423 | 3u0g | 4whx | https://www.sciencedirect.com/science/article/pii/S0300908418303626 | Biochemical and structural insights into PLP fold type IV transaminase from Thermobaculum terrenum | 2019 | EY Bezsudnova, KM Boyko, AY Nikolaeva, YS Zeifman- Biochimie, 2019 - Elsevier | The results of independent MD simulations were qualitatively the same. 2.11. Structural analysis of the fold type IV PLP-dependent enzymes. Proteins which are structurally similar to TaTT were collected from the PDB bank using the structure similarity search module... similar short distance between the tyrosine OH group and the O3 atom of PLP was found in the BCAT structure from Burkholderia pseudomallei (PDB ID: 3U0G, 4WHX). |
| 424 | 4qfh | 4g7f, 4gie | https://www.mdpi.com/2218-273X/9/9/484 | Insights into Ergosterol Peroxide's Trypanocidal Activity | 2019 | T Meza-Menchaca, A Ramos-Ligonio- Biomolecules, 2019 - mdpi.com | \To identify potential Tc proteins that might directly interact with ergosterol peroxide, an inverse-docking screening was performed on a subset of Tc protein crystallography structures.. Table 1. The best matches between T. cruzi proteins and ergosterol peroxide in descending order of ∆G predictive value ... Dihydroorotate dehydrogenase 4QFH 3W1R −9.1 −11.17 6.407 |
| 425 | 4e51 | - | https://tel.archives-ouvertes.fr/tel-02484790/ | Incorporation de la beta alanine dans des polypeptides | 2019 | G Nigro - 2019 - tel.archives-ouvertes.fr | 89 I. 2 Structures de la MetRS cocristallise avec des analogues de la mthionine : Sites de reconnaissance des acides aminés de trois AARS de classe II. A : HisRS de Burkholderia thailandensis (4E51), B : |
| 426 | 2lbb | 2l4b | https://arxiv.org/abs/1901.00991 | Physical Folding Codes for Proteins | 2019 | X Ma, C Hou, L Shi, L Li, J Li, L Ye, L Yang- arXiv preprint arXiv, 2019 - arxiv.org | 15 Soares, CM, Teixeira, VH & Baptista, AM Protein Structure and Dynamics in Nonaqueous Solvents: Insights from Nature Structural Biology 10, 980, doi:10.1038/nsb1203-980 (2003 JL The worldwide Protein Data Bank (wwPDB): ensuring a single, uniform archive of PDB data |
| 427 | 3qhd | 3P0Z, 3p0z | http://commons.lib.niu.edu/handle/10843/21551 | Design, synthesis, and evaluation of potential Burkholderia pseudomallei IspF inhibitors | 2019 | S Watkins - 2019 - commons.lib.niu.edu | xvi nOe Nuclear Overhauser enhancement/nuclear Overhauser effect PDB Protein Data Bank Pf Plasmodium falciparum ppm Parts per million RST Relative saturation transfer SAR Structure activity relationship SSGCID Seattle Structural Genomics Center for Infectious Disease ... It is possible the sp2 N of the imidazole is binding to the Zn2+, as seen in the crystal structures of 88 in BpIspF (3P0Z, 3QHD). |
| 428 | 3tv2 | 3rd8, 3qbp, 3gtd | https://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.14782 | Structural, biochemical and biophysical characterization of recombinant human fumarate hydratase | 2019 | MA Ajalla Aleixo, VL Rangel, JK Rustiguel- The FEBS, 2019 - Wiley Online Library | code: 3GTD; [37]), Burkholderia pseudomallei FH (BpFH, PDB code: 3TV2 ; results not (MsFH, PDB code: 3RD8; [38]). The superposition of C atoms between HsFH and the From the structure -based drug design perspective, it is imperative to identify |
| 429 | 4pfz | 3rr6, 3qdf | https://www.sciencedirect.com/science/article/pii/S0006291X18328705 | Structural and functional analysis of a dimeric fumarylacetoacetate hydrolase (EaFAH) from psychrophilic Exiguobacterium antarcticum | 2019 | W Yoo, CW Lee, B Kim, LTHL Le, SH Park- Biochemical and, 2019 - Elsevier | overall monomer structure , a schematic diagram of the connectivity, and the residue numbering of each secondary structure are shown in ID:3RR6, Z score: 34.6), a 5-carboxymethyl-2- hydroxymuconate delta-isomerase from Mycobacterium smegmatis ( PDB ID: 4PFZ ; Z score |
| 430 | 6mb1 | 6mb0, 6may, 6maz | https://spiral.imperial.ac.uk/handle/10044/1/85451 | N-myristoyltransferase inhibitor binding mode and phenotype in the malarial parasite. | 2019 | AC Schlott - 2019 - spiral.imperial.ac.uk | lacks myristoylation and instead contains a hydro- phobic N-terminal sequence interacting with the Golgi membrane; its location resembles the distribution of GRASP1, but its structure may result 2010) N-Myristoyltransferase from Leishmania donovani: Structural and Functional ... One of them is the aminomethylindazole series including compounds IMP-0917 (PDB: 5O6H) (Mousnier et al. 2018), and IMP-1002 (PDB: 6MB1) (Schlott et al. 2019) |
| 431 | 3pk0 | 5if3 | https://pubs.acs.org/doi/abs/10.1021/acscatal.9b00621 | Two enantiocomplementary Ephedrine Dehydrogenases from Arthrobacter sp. TS-15 with broad substrate specificity | 2019 | T Shanati, C Lockie, L Beloti, G Grogan- ACS, 2019 - ACS Publications | provide a detailed insight into both the functional and structural characteristics of PseDH and EDH.. A comparison with 30 structures of SDRs from bacterial species in the PDB suggests that S143 is most commonly a small hydrophobic residue, such as G, A, or V, whereas W152 is most commonly an H, M, or L, although in SDRs from Burkholderia vietnamiensis (5IF3) and Mycobacterium smegmatis (3PK0) the residue is W |
| 432 | 4hvt | 3s6m, 5tnx | https://pubs.acs.org/doi/abs/10.1021/acs.jcim.8b00777 | SPOT-peptide: Template-based prediction of peptide-binding proteins and peptide-binding sites | 2019 | T Litfin, Y Yang, Y Zhou- Journal of chemical information and, 2019 - ACS Publications | test set taken from another structure -based peptide-binding site predictor, SPRINT- peptide11 Structural genomics targets (SG4444) 11,813 proteins involved in structural genomics studies were collected from the PDB plate primarily based on domain-level structural similarity |
| 433 | 5unb | - | https://ora.ox.ac.uk/objects/uuid:bd3dc30e-2835-45d8-b1ba-dafa2f552e98/download_... | Janus kinase inhibition for autoinflammation in DNASE2 deficiency | 2019 | S Nanthapisal, A Cavounidis, H Takeshita- Journal of Allergy and, 2019 - ora.ox.ac.uk | Structural modeling Structural models and figures were prepared by using the ICM software package (MolSoft, San Diego, Calif). A homology model for human DNase II was prepared by using the existing structure from B thailandensis ( PDB 5UNB ) as the model template |
| 434 | 3rd5 | - | https://www.mdpi.com/2073-4352/9/10/533 | Trial Direct Phasing Calculation of A Thyroid Hormone Receptor Alpha Structure (4LNW) | 2019 | M Jiang, H He, WP Su- Crystals, 2019 - mdpi.com | It is worth mentioning that 3RD5 is a test structure with the lowest solvent content that we have successfully applied the direct method to. 4. Methodology After locating the two ligands, MJ and HH were informed that the test structure has the PDB code 4LNW |
| 435 | 3dah | - | https://bmcstructbiol.biomedcentral.com/articles/10.1186/s12900-019-0100-4 | Crystal structure of E. coli PRPP synthetase | 2019 | W Zhou, A Tsai, DA Dattmore- Structural, 2019 - bmcstructbiol.biomedcentral.com | Overall, this study details key structural features of an enzyme that catalyzes a critical step in nucleotide metabolism The structure was solved by molecular replacement using the PRPP synthetase from Burkholderia pseudomallei ( PDB 3DAH ) as the search model [14] |
| 436 | 6b4a | - | https://www.biorxiv.org/content/10.1101/623140v1.abstract | A doublecortin-domain protein of Toxoplasma and its orthologues bind to and modify the structure and organization of tubulin polymers | 2019 | JM Leung, E Nagayasu, YC Hwang, P Pierce, IQ Phan- bioRxiv, 2019 - biorxiv.org | Page 5. 5 more in-depth analysis of the conoid fiber architecture , and a comparison of TgDCX and its eight residues 51-128, rmsd 1.905 ); TgDCX ( 6B4A , chain A, aa150-222) vs DCX domains (Figure 5A, Table 1), we used the structure of TgDCX148-243 as a model for |
| 437 | 3r1i | - | http://www.jbc.org/content/early/2019/06/17/jbc.RA119.009390.short | Structural and biochemical characterization of 20-hydroxysteroid dehydrogenase from Bifidobacterium adolescentis strain L2-32 | 2019 | HL Doden, RM Pollet, SM Mythen, Z Wawrzak- Journal of Biological, 2019 - ASBMB | replacement with the structure of an SDR from Mycobacterium marinum ( PDB : 3R1I ) and refined indicate these alanine substitutions did not sig- nificantly affect secondary structural elements (Fig extended N-terminus is important for second- ary and quaternary structure In both |
| 438 | 6c5v | - | https://books.google.com/books?hl=en&lr=&id=32CqDwAAQBAJ&oi=fnd&pg=PA313&dq=%226... | Gammaherpesvirus entry and fusion: A tale how two human pathogenic viruses enter their host cells | 2019 | BS Mhl, J Chen, R Longnecker- Adv. Virus Res, 2019 - books.google.com | 323 Gammaherpesvirus entry and fusion (Waterhouse et al., 2018) based on the crystal structures of EBV gB ( PDB ID: 3FVC), gH ( 6C5V ) and gL The structural sequence alignment of EBV and KSHV gB based on the crystal structure of EBV gB (3FVC)(Backovic et al., 2009 |
| 439 | 4ol9 | - | https://www.sciencedirect.com/science/article/pii/S0304416519301382 | Genome-wide survey and crystallographic analysis suggests a role for both horizontal gene transfer and duplication in pantothenate biosynthesis pathways | 2019 | B Khanppnavar, R Chatterjee, GB Choudhury- et Biophysica Acta (BBA, 2019 - Elsevier | helix in the N-terminal domain (H2, residues 3341) which is typically absent in other well-characterized KPRs such as Escherichia coli (1KS9), S. aureus (4YCA), and M. tuberculosis ( 4OL9 ) (C) Cartoon representation of crystal structure of PaKPR in PDB accession, 5ZIK, 5ZIX |
| 440 | 4lfy | - | https://www.sciencedirect.com/science/article/pii/S0141813019322287 | Pyrimidine biosynthesis in pathogensStructures and analysis of dihydroorotases from Yersinia pestis and Vibrio cholerae | 2019 | J Lipowska, CD Miks, K Kwon, L Shuvalova- International journal of, 2019 - Elsevier | As the first DHO structure ( PDB ID 1J79) was deposited in 2001, structural information was not available to guide the DHO classification proposed in 1999. In 2014, an updated phylogenetic tree based on structure -guided sequence alignments using structures available for nine .. Table 1 Burkholderia cenocepacia 4LFY 2013 Structural genomics (SSGCID) |
| 441 | 4iwh | - | https://pubs.acs.org/doi/abs/10.1021/acscentsci.8b00912 | Predicting Protein Complex Structure from Surface-Induced Dissociation Mass Spectrometry Data | 2019 | JT Seffernick, SR Harvey, VH Wysocki- ACS Central, 2019 - ACS Publications | from which data have been favorably compared to known crystal structures on many along with other bioanalytical MS and dissociation techniques, yields useful structural information, the sparse, not allowing for an unambiguous determination of the protein complex structure... Additionally, the Pnear also improved for 56/57 ideal cases (except 4IWH) when SID data were used, as shown in Figure S3A. |
| 442 | 4l82 | - | https://www.sciencedirect.com/science/article/pii/S2405844019358530 | Simulation-based protein engineering of R. erythropolis FMN oxidoreductase (DszD) | 2019 | R Fallahzadeh, B Bambai, K Esfahani, AA Sepahi- Heliyon, 2019 - Elsevier | their PDB information, the multiple alignments of these 22 PDB files was done with the DszD. pdb (Fig 1. Predicted three dimensional structure for wild-type DszD enzyme residues (Asn or Ile residue instead of Ala79) were presented on the 3K88 and 4L82 homologous proteins |
| 443 | 4k73 | - | https://pubs.acs.org/doi/abs/10.1021/acsinfecdis.8b00244 | Structural Basis for the Interaction and Processing of -Lactam Antibiotics by l,d-Transpeptidase 3 (LdtMt3) from Mycobacterium tuberculosis | 2019 | GA Libreros-Ziga, C dos Santos Silva- ACS Infectious, 2019 - ACS Publications | Structural Basis for the Interaction and Processing of -Lactam Antibiotics by l,d-Transpeptidase 3 These structures revealed a fold and catalytic diad similar to those of other Ldts Mt The Ldt Mt3 faropenem structure indicated that faropenem is degraded after Cys-246 acylation The phases were obtained by molecular replacement with Phaser53 from CCP4 suite,54 adopting the PDB entries 4K73 and 5DU727 as models for LdtMt3 and LdtMt5 structures, respectively |
| 444 | 4k9d | - | https://link.springer.com/article/10.1007/s00436-019-06225-w | Identification and characterization of glyceraldehyde 3-phosphate dehydrogenase from Fasciola gigantica | 2019 | PB Chetri, R Shukla, T Tripathi- Parasitology research, 2019 - Springer | homologs, and the structure of the GAPDH of Brugia Malayi ( PDB ID: 4K9D ) was selected After validation, the modeled structure was used for binding site prediction. The binding site was predicted using the PDB structure co-crystallized with substrate and cofactor (Frayne et al |
| 445 | 4lgv | - | https://pubs.acs.org/doi/abs/10.1021/acscatal.9b02413 | Artificial Multienzyme Scaffolds: Pursuing in Vitro Substrate Channeling with an Overview of Current Progress | 2019 | GA Ellis, WP Klein, G Lasarte-Aragones, M Thakur- ACS, 2019 - ACS Publications | Within each material class of scaffolds, attention is given to their inherent chemical diversity, how they are engineered, how they allow for enzymatic attachment, their ease of use, their benefits (eg, inherent three-dimensional architecture ) ... Illustration of the proposed channeling complex using a poly(lysine) bridge as an electrostatic surface between hexokinase (HK) (PDB entry 3VF6) and glucose-6-phosphate dehydrogenase (G6PDH) (PDB entry 4LGV). |
| 446 | 4kzk | - | https://www.preprints.org/manuscript/201909.0313 | Structural Flexibility of Peripheral Loops and Extended C-Term Domain of Short Length Substrate Binding Protein from Rhodothermus marinus | 2019 | JE Bae, IJ Kim, Y Xu, KH Nam - 2019 - preprints.org | 120 analysis and substrate docking studies using previously reported crystal structure of SBP ( PDB 121 code 5Z6V) as starting point model structure Among them, 9 models ( PDB code: 123 2QH8, 3LFT, 5ER3, 6DSP, 5BRA, 3KSM, 2DRI, 5DTE, 4KZK , 4RS3, 8ABP) with |
| 447 | 3uf8 | - | https://www.mdpi.com/2076-3417/9/24/5389 | Carotenoids Overproduction in Dunaliella Sp.: Transcriptional Changes and New Insights through Lycopene Cyclase Regulation | 2019 | F Elleuch, HB Hlima, M Barkallah, P Baril, S Abdelkafi- Applied Sciences, 2019 - mdpi.com | and cytochrome b 6 /f complex and maintains the integrity of cell architecture [7]. It attempted to understand how this stress could affect LCYB molecule by generating its 3D structure to 200 bp, chosen temperature (Tm) around 60 C, and avoiding secondary structures and self |
| 448 | 3rr2 | - | https://link.springer.com/article/10.1007/s13205-019-1572-4 | Insights into multifaceted activities of CysK for therapeutic interventions | 2019 | P Joshi, A Gupta, V Gupta- 3 Biotech, 2019 - Springer | PDB ID (References) 3RR2 (Baugh et al A recent study where a natural A241V variant of S. flexneri CysE has unstable quaternary assembly and reduced activity, suggests transient dissociation of quaternary structure of CysE to be another regulatory mechanism for cysteine |
| 449 | 4fkx | - | https://www.sciencedirect.com/science/article/pii/S0006291X1930155X | Characterization of crystal structure and key residues of Aspergillus fumigatus nucleoside diphosphate kinase | 2019 | Y Hu, X Jia, Z Lu, L Han- Biochemical and biophysical research, 2019 - Elsevier | was determined by molecular replacement (MR) method using Trypanosoma brucei NDK (TbNDK, PDB code 4FKX ) as starting The PDB accession code was 6AGY 1230-1247. Google Scholar. [9] L. Moynie, MF Giraud, F. Georgescauld, I. Lascu, A. DautantThe structure of the |
| 450 | 5cy4 | - | http://rnajournal.cshlp.org/content/early/2019/03/29/rna.070557.119.abstract | Structural insights into nanoRNA degradation by human Rexo2 | 2019 | LY Chu, S Agrawal, YP Chen, WZS Yang, HS Yuan- RNA, 2019 - rnajournal.cshlp.org | 6A4E), or deposited in the protein data bank, including those from E. coli ( PDB codes: 1YTA, 2IGI), Acinetobacter baumannii ( PDB code: 5CY4 ), and Haemophilus influenzae ( PDB code 1J9A) Structural coordinates and diffraction structure factors of Rexo2-RNA, Rexo2-DNA1 |
| 451 | 3f9i | - | https://repositories.lib.utexas.edu/handle/2152/74541 | Identifying Novel Inhibitors of RpFabG in Typhus-inducing Rickettsia prowazekii | 2019 | A Panatpur - 2019 - repositories.lib.utexas.edu | The Virtual Cures stream streamlines the aforementioned process by virtually analyzing the structural and chemical bonding relationships a 3-dimensional crystal structure is present for 3-ketoacyl-(acyl-carrier-protein) reductase [ PDB 3F9I ], the available structure has not |
| 452 | 3enk | - | https://www.nature.com/articles/s41598-019-47591-w | Structural basis for broad substrate specificity of UDP-glucose 4-epimerase in the human milk oligosaccharide catabolic pathway of Bifidobacterium longum | 2019 | YW Nam, M Nishimoto, T Arakawa, M Kitaoka- Scientific reports, 2019 - nature.com | Here, we focused on structural features of GalE from B. longum JCM1217 (bGalE) The main chain structure of bGalE is similar to those of bacterial and eukaryotic GalEs. C RMSD values (distance cutoff = 2.0 ) of the UDP-GlcNAc complex with hGalE ( PDB ID 1HZJ, ... We built a reliable homology model of BLLJ_1592 (GQME = 0.72 and QMEAN = −2.34) using the SWISS-MODEL server45 with an unpublished structure of GalE from Burkholderia pseudomallei (PDB ID: 3ENK, sequence identity = 42.3%) as a template |
| 453 | 4yet | 4f2n | https://onlinelibrary.wiley.com/doi/abs/10.1002/minf.201900052 | Tropical and Subtropical Parasitic Diseases: Targets for a New Approach to Virtual Screening | 2019 | MJR Yunta, RC Dietrich- Molecular informatics, 2019 - Wiley Online Library | The most stable extended geometry was always used as the starting structure in all SODb2 (glycosomial), 2GOJ for Plasmodium Falci- parum Fe-SODb1 (cytosolic) and 4YET for Babesia Starting water molecules positions were those published in the corresponding PDB library |
| 454 | 4f2n | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/ardp.201800299 | Antileismanial activity, mechanism of action study and molecular docking of 1, 4bis (substituted benzalhydrazino) phthalazines | 2019 | AH Romero, N Rodrguez, H Oviedo- Archiv der, 2019 - Wiley Online Library | candidate for further pharmacokinetic and in vivo experiments as antileishmanial agent, and as a platform for further structural optimization ... Representation of molecular docking of 1,4‐bis‐(substituted benzalhydrazino) phthalazine 3b on the superoxidedismutase active sites of Leishmania major (PDB code: 4F2N) |
| 455 | 4f2n | - | https://scripts.iucr.org/cgi-bin/paper?or5020 | Crystal structure of an iron superoxide dismutase from the pathogenic amoeba Acanthamoeba castellanii | 2019 | O Dao, K Asaithambi, BK Na, KH Lee- Section F: Structural Biology, 2019 - scripts.iucr.org | et al., 2014), P. falciparum ( PDB entry 2bpi; Boucher et al., 2006) and L. major ( PDB entry 4f2n ; Phan et al., 2015) and of MnSOD from Homo sapiens ( PDB entry 5vf9 architecture of AcFeSOD is similar to those of other Fe/MnSODs, including the E. coli FeSOD structure (Fig |
| 456 | 4j3g | - | https://scholarworks.sjsu.edu/etd_projects/829/ | PREDICTING SWITCH-LIKE BEHAVIOR IN PROTEINS USING LOGISTIC REGRESSION ON SEQUENCE-BASED DESCRIPTORS | 2019 | B Strauss - 2019 - scholarworks.sjsu.edu | set. Validated residue binary assignments of 0 (no change in secondary structure ) and 1 (change in secondary structure ) were determined (DSSP) from 3D X-ray structures for sets of virtually identical chains crystallized under different conditions |
| 457 | 4e98 | 4iyq | https://riunet.upv.es/handle/10251/117999 | Bases estructurales de la sealizacin y regulacin por nitrgeno y procesos asociados. | 2019 | L Tremio Agull - 2020 - riunet.upv.es | PDB : banco de datos de protenas (Protein Data Bank: https://www.rcsb.org/ pdb /home/home. do) PEG 49 Captulo 1: Studies on cyanobacterial protein PipY shed light on structure , potential functions Functional and structural studies in bacteria ----- 117 |
| 458 | 3laa | - | https://www.sciencedirect.com/science/article/pii/S1047847719301728 | Structure of the UspA1 protein fragment from Moraxella catarrhalis responsible for C3d binding | 2019 | KM Mikula, R Kolodziejczyk, A Goldman- Journal of structural biology, 2019 - Elsevier | 2012) as found in SadA (2YO2, 2YNZ) (Hartmann et al., 2012) or BpaA ( 3LAA ) (Edwards et CCP4 package (Winn et al., 2011) with the structure of UspA1 165366 ( PDB : 3PR7) (Agnew Model of UspA1 299452 structure solved in this study, neck and coiled-coil domains; chain |
| 459 | 4ffc | - | https://www.sciencedirect.com/science/article/pii/S0006291X19308538 | Crystal structure of -aminobutyrate aminotransferase in complex with a PLP-GABA adduct from Corynebacterium glutamicum | 2019 | J Hong, KJ Kim- Biochemical and biophysical research communications, 2019 - Elsevier | microorganisms, including P. aurescens (PaGABA-AT, PDB code 4ATP), Mycobacterium abscessus (MaGABA-AT, PDB code 4FFC ), and E. coli (EcGABA-AT, PDB code 1SF2) (Fig of CgGABA-AT with that of other GABA-ATs, we superimposed the CgGABA-AT structure and all |
| 460 | 3nf4 | - | https://www.mdpi.com/2073-4352/9/11/548 | Crystal Structures of Putative Flavin Dependent Monooxygenase from Alicyclobacillus Acidocaldarius | 2019 | H Moon, S Shin, J Choe- Crystals, 2019 - mdpi.com | was obtained using the Molrep program of CCP4 package [13] with Acyl-CoA dehydrogenase (M. thermoresistibile) structure ( PDB ID: 3NF4 ) as a The data collection and refinement statistics are summarized in Table 1. The coordinate and structure factors for apo and FAD |
| 461 | 4egq | 4eg0, 4egj | https://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.14976 | Burkholderiapseudomallei dalaninedalanine ligase; detailed characterisation and assessment of a potential antibiotic drug target | 2019 | L DazSez, LS Torrie, SP McElroy, D Gray- The FEBS, 2019 - Wiley Online Library | An apo-BpDdl structure ( PDB code 4EGQ ) has been determined by the Seattle Structural Genomics Center for Infectious Disease. Electron and difference density maps in the ATP binding sites were inspected to ascertain if a ligand might be present |
| 462 | 4whx | 3u0g | https://www.sciencedirect.com/science/article/pii/S1570963919300494 | Functional characterization of PLP fold type IV transaminase with a mixed type of activity from Haliangium ochraceum | 2019 | YS Zeifman, KM Boyko, AY Nikolaeva- et Biophysica Acta (BBA, 2019 - Elsevier | These results complement our knowledge of the catalytic diversity of transaminases and indicate the need for further research to understand the structural basis of substrate specificity in these enzymes. Abbreviations PDB entry code, 6H65. 2.8. Structure solution and refinement |
| 463 | 5jy1 | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/adsc.201900144 | Clean Enzymatic Oxidation of 12Hydroxysteroids to 12OxoDerivatives Catalyzed by Hydroxysteroid Dehydrogenase | 2019 | F Tonin, N Alvarenga, JZ Ye- Advanced Synthesis, 2019 - Wiley Online Library | MODEL (https://swissmodel.expasy.org/ interactive), employing the crystal structure of the putative SDR from Burkholderia xenovorans ( PDB ID: 5JY1 .1) as determination of the cosubstrate specificity of these enzymes.[11] The 3D model of the El12-HSDH structure showed a |
| 464 | 3v7o | - | https://link.springer.com/article/10.1007/s00018-019-03303-1 | Global phosphoproteomic analysis of Ebola virions reveals a novel role for VP35 phosphorylation-dependent regulation of genome transcription | 2019 | A Ivanov, P Ramanathan, C Parry, PA Ilinykh- Cellular and Molecular, 2019 - Springer | Three-dimensional structural models were built for NP, VP35, VP40, GP, VP30 and VP24 proteins using available crystal structures or by de novo structure prediction to elucidate the potential role of the phosphorylation sites |
| 465 | 3uam | - | https://link.springer.com/chapter/10.1007/978-981-13-7318-3_6 | Chitin-Active Lytic Polysaccharide Monooxygenases | 2019 | G Courtade, FL Aachmann- Targeting Chitin-containing Organisms, 2019 - Springer | 3UAM . Likely active on chitin. To be published The structures were made using PyMol and the PDB code 2BEM. The copper coordinates were extracted from the PDB code 2YOX The structure is stabilized by hydrophobic residues, as well as by one or two disulfide bridges CANNOT DECIDE, RIGHT TARGET AND FIND PART OF ABOVE SENTENCES BUT NOT 3UAM |
| 466 | 4g7f | - | http://www.academiajournals.com/s/8-Tesis-Sotelo-Baltazar-Carlos-Alexis.pdf | HUMANIDADES, CIENCIA, TECNOLOGA E INNOVACIN EN PUEBLA | 2019 | CAS BALTAZAR, UNMM INMUNIZADO, C ORAL - academiajournals.com | Page 1. HUMANIDADES, CIENCIA, TECNOLOGA E INNOVACIN EN PUEBLA ISSN 2644-0903 online VOL. 2, NO. 1, 2020 WWW.ACADEMIAJOURNALS.COM TRABAJO DE INVESTIGACIN AUSPICIADO POR EL CONVENIO CONCYTEP-ACADEMIA JOURNALS |
| 467 | 3uam | - | https://www.sciencedirect.com/science/article/pii/S1093326318306776 | Structural dynamics of lytic polysaccharide monoxygenases reveals a highly flexible substrate binding region | 2019 | R Arora, P Bharval, S Sarswati, TZ Sen- Journal of Molecular, 2019 - Elsevier | pdb ) id: 2vtc, 2yet, 3zud, 4b5q, 4eir, 4qi8, 5acf, 5aci, 5acj, 5foh, 5tkf, 5tkg, 5tkh, and 5tki) and 10 structures in AA10 ( pdb id: 2bem, 3uam , 4ow5, 4oy6 MSF correlation value of 0.58 or higher (Table 1). In the case of AA11 and AA13 there was only one structure , 4mah and 5t7j |
| 468 | 3u5w | - | https://www.sciencedirect.com/science/article/pii/S1047847719300516 | The crystal structure of Rv2991 from Mycobacterium tuberculosis: An F420 binding protein with unknown function | 2019 | S Benini, A Haouz, F Proux, P Alzari- Journal of structural biology, 2019 - Elsevier | from M. tuberculosis in complex with F 420 (Ahmed et al., 2016); 3U5W uncharacterized protein of secondary structural elements of the query (Rv2991) that match the target structure by the sequence similarity search by BLASTp when Rv2991was compared to the whole PDB |
| 469 | 3tf6 | - | https://www.research-collection.ethz.ch/bitstream/handle/20.500.11850/337776/1/H... | Neural networks for improving drug discovery e fficiency | 2019 | H Hassan Harrirou - 2019 - research-collection.ethz.ch | The PDBBind 2018 general set version contains 19588 biomolecu- lar structures , for which some SMILES or FASTA), or full 3D representations of atom coordinates (ie PDB ), with bonds preferable properties of inputs to most machine-learning algorithms: a fixed-size structure |
| 470 | 3swt | - | https://rc.library.uta.edu/uta-ir/handle/10106/29306 | Non-Heme Iron Oxygenases: An Investigation of the Protein Ligand Effects on the Chemical Reactivity in MiaE and Cysteamine Dioxygenases | 2019 | P Palacios - 2019 - rc.library.uta.edu | enzyme toluene monooxygenase in Figure 1.1 (panel B).14 The structural frame of the non-heme iron Figure 1.2 X-ray crystal structure of the Fe(II)/-ketoglutarate dependent enzyme TauD from Myobacterium marinum ( PDB : 3SWT )22 Page 22. 10 |
| 471 | 5u25 | - | https://www.mdpi.com/2077-0383/8/12/2117 | FAD/NADH Dependent Oxidoreductases: From Different Amino Acid Sequences to Similar Protein Shapes for Playing an Ancient Function | 2019 | L Trisolini, N Gambacorta, R Gorgoglione- Journal of Clinical, 2019 - mdpi.com | Here, we present a structural comparative analysis showing that the investigated flavoprotein oxidoreductases have a highly similar overall structure , although the investigated Similarly, AIF-crystallized structure hosts a FAD and two NADH molecules (4bur. pdb , [26]) and |
| 472 | 5vwm | - | https://pdfs.semanticscholar.org/1774/b2148932698ea43fe239489547556ff273f3.pdf | In silico study of various compounds from essential oil of Cymbopogon winterianus against Pseudomonas aeruginosa targets | 2019 | Moura, A Monteiro, M Maia, N Sousa, G Rodrigues - 2019 - pdfs.semanticscholar.org | Protein resolution values were 2.1 for ExoA ( PDB ID 1XK9), 1.8 for LpxC ( PDB ID 5VWM ) and 2.31 for PBP3 ( PDB ID 4KQO). All presented inhibitors coupled to their crystallographic structure , which allowed the delimitation of the active site of each protein |
| 473 | 5b8h | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/cmdc.201800652 | Identification of Specific and Nonspecific Inhibitors of Bacillus anthracis TypeIII Pantothenate Kinase (PanK) | 2019 | JA Shapiro, JJ Varga, D Parsonage, W Walton- , 2019 - Wiley Online Library | Organic synthesis of analogues along with biochemical validation of the proposed mechanism will allow structure function analysis and form 2H3G, DOI: 10.2210/pdb2H3G/ pdb ), PaPanK ( PDB ID: 2F9T, DOI: 10.2210/pdb2F9T/ pdb ), and BcPanK ( PDB ID: 5B8H , DOI: 10.2210 |
| 474 | 3r9r | - | https://royalsocietypublishing.org/doi/abs/10.1098/rsta.2018.0422 | Structure-guided fragment-based drug discovery at the synchrotron: screening binding sites and correlations with hotspot mapping | 2019 | SE Thomas, P Collins, RH James- of the Royal, 2019 - royalsocietypublishing.org | purine biosynthesis in maintaining the viability of cells and differences in the structural architecture of bacterial The crystals are similar to those of a previously determined structure of MabPurC with a monomer in the asymmetric unit (figure 1b) ( PDB 3R9R , Seattle Structural |
| 475 | 3kre | - | http://www.freepatentsonline.com/y2019/0209493.html | NOVEL APPLICATIONS OF SPERMINE AND DERIVATIVES THEREOF | 2019 | W Pan, W Zhu- US Patent App. 16/334,273, 2019 - freepatentsonline.com | Thermotoga maritime (1KUT), Clostridium perfringens (3NUA), Ehrlichia chaffeensis ( 3KRE ), Geobacillus kaustophilus On the basis of the above results, the crystal structure conformations in of Saccharormyces cerevisiae ( PDB : 2CNQ) and Escherichia coli ( PDB : 2GQS) are |
| 476 | 2klx | - | http://rave.ohiolink.edu/etdc/view?acc_num=osu1554977217363556 | Studies in Computational Biochemistry: Applications to Computer Aided Drug Discovery and Protein Tertiary Structure Prediction | 2019 | ML Aprahamian - 2019 - rave.ohiolink.edu | structures were identified using a receiver operator characteristic (ROC) analysis and a set of known binding compounds. Using these structures as the receptors for structure -based drug discovery, a virtual screen was performed on the National Cancer Institute's ... The six proteins selected from the ab initio set were PDB ID 1tpm, 2klx, 2nc2, 2y4q, 3iql, and 4omo. |
| 477 | 3sbx | - | https://www.sciencedirect.com/science/article/pii/S1097276519302606 | (p) ppGpp Regulates a Bacterial Nucleosidase by an Allosteric Two-Domain Switch | 2019 | YE Zhang, RL Brentsen, T Fuhrer, U Sauer, K Gerdes- Molecular cell, 2019 - Elsevier | marinum showing similarity to the PpnN core domain and determined in the presence of adenosine monophosphate (AMP) ( PDB : 3SBX , Figure S3 Vibrio cholerae and Idomarina baltica, at a similar position to the phosphate of AMP in the M. marinum structure , suggesting that |
| 478 | 6n38 | - | https://www.frontiersin.org/articles/10.3389/fmicb.2019.01615/abstract | Baseplate component TssK and spatio-temporal assembly of T6SS in Pseudomonas aeruginosa | 2019 | D Liebl, M Robert-Genthon, V Job, V Cogoni- Frontiers in, 2019 - frontiersin.org | TssE is the structural homolog of the T4 phage baseplate components gp25 (Leiman et al To confirm that TssK and TssE assemble into the same spot-like structure we generated and Mekalanos, 2012; Vettiger and Basler, 2016), very low number of TssB- structures were seen... The TssK oligomers disassemble upon action of PppA (shown in dashed lines). Stoichiometry (TssK3)2(TssF2/TssG) in accordance with cryo-EM structure (PDB 6N38) is shown. |
| 479 | 3gwc | - | http://search.proquest.com/openview/aa0a9dc6c9a061aa0200e2456abf28ac/1?pq-origsi... | Virtual Screening of Novel Potent Molecules Targeting enoyl-ACP reductase as Antitubercular Agents by Molecular Docking studies | 2019 | V Shivakumar, PM Ramsana, M Risfa- Journal of, 2019 - search.proquest.com | Fig 2. Structure and portions nomenclature of linezolid V. Shivakumar et al /J. Pharm. Sci. & Res NO. PDB ID RESOLUTION ENZYMES YEAR 1 2AF6 2.01 Trymidylate synthase 2005 2 2X23 1.80 enoyl-ACP reductase 2010 3 3GWC 1.9 Trymidylate synthase 2009 |
| 480 | 3s99 | - | https://www.sciencedirect.com/science/article/pii/S037811191930160X | Identification and characterization of ABC transporters for carbohydrate uptake in Thermus thermophilus HB8 | 2019 | M Chandravanshi, A Sharma, PD Gupta, SK Mandal- Gene, 2019 - Elsevier | substantiate the relationship of TTHV089 with XBPs, its three-dimensional tertiary structure was predicted All the programs utilized XBP from E. coli (EcXBP, PDB id: 3M9W, open Further, the structural homology search using the predicted model of TTHV089 shows that apart |
| 481 | 4f0l | - | http://search.proquest.com/openview/fef1d24d7e6ff92856571d1305df8aa5/1?pq-origsi... | Structural and Biochemical Studies of C. jejuni Agmatine Deiminase, E. coli Guanine Deaminase, and S. cerevisiae Guanine Deaminase | 2019 | R Shek - 2019 - search.proquest.com | to uric acid by xanthine oxidase. Figure 1.4. Structure of triose phosphate isomerase. PDB : 6B2W. The beta strands that make up the TIM barrel are shown in red. Page 24. 11 catalyze deamination reactions, the two families differ substantially in their structural architectures. 27 |
| 482 | 3s99 | - | https://scripts.iucr.org/cgi-bin/paper?jb5014 | The evolving story of AtzT, a periplasmic binding protein | 2019 | ML Dennis, L Esquirol, T Nebl, J Newman- Section D: Structural, 2019 - scripts.iucr.org | (2019). D75, 9951002 Page 5. cluster protein and had electron density in the binding site for a purine. Post hoc analysis of the structure and sequence showed that PDB entry 3s99 has 54% sequence identity and an rmsd of 1.2A (over $330 residues) to AtzT |
| 483 | 3pfd | - | https://www.sciencedirect.com/science/article/pii/S0141022918305313 | Site-directed mutation to improve the enzymatic activity of 5-carboxy-2-pentenoyl-CoA reductase for enhancing adipic acid biosynthesis | 2019 | J Yang, Y Lu, Y Zhao, Z Bai, Z Ma, Y Deng- Enzyme and Microbial, 2019 - Elsevier | 3PFD was the PDB ID of the template. Therefore, we used 3PFD as the template to build the homology model of Tfu_1647 protein using DS 2017R2 [17] We then used the Deriding-like force field in DS 2017R2 to optimize the structure to ensure that we produced a |
| 484 | 2mj3 | - | https://www.frontiersin.org/articles/10.3389/fenrg.2019.00079/abstract | Evolutionary relationships between low potential ferredoxin and flavodoxin electron carriers | 2019 | IJ Campbell, GN Bennett, JJ Silberg- Frontiers in Energy Research, 2019 - frontiersin.org | This bioinformatic study highlights understudied PECs whose structure , stability, and partner specificity should be 1CZP, 2WLB, 3LXF, 1B9R, 1UWM, 1PDX, 1M2D, 1I7H, 3AH7, 2MJD, 2MJ3 , 2Y5C, 5FFI For Flds, we used PDB IDs 2FZ5, 1FLD, 4HEQ, 2HNA, 2FX2, 3F6R, 3KAP |
| 485 | 3qxz | - | https://link.springer.com/article/10.1007/s12257-018-0393-3 | Crystal Structure of a Novel Type Isomerase of Enoyl-CoA Hydratase/Isomerase Family Protein from Cupriavidus necator H16 | 2019 | H Seo, KJ Kim- Biotechnology and Bioprocess Engineering, 2019 - Springer | code 5Z7R, Z-score 31.5 and 1.7 rmsd) and probable enoyl- CoA hydratase/isomerase from Mycobacterium abscessus ( PDB code 3QXZ , Z-score has highly conserved enoyl-CoA hydratase fold but its functional implication cannot be obtained from the overall structure |
| 486 | 5ts2 | 3pxu | https://www.sciencedirect.com/science/article/pii/S0141813019351451 | Structural and biochemical studies of phosphopantetheine adenylyltransferase from Acinetobacter baumannii with dephospho-coenzyme A and coenzyme A | 2019 | A Gupta, PK Singh, P Sharma, P Kaur, S Sharma- International journal of, 2019 - Elsevier | pseudolamelli (BpPPAT, PDB ID: 3PXU), Mycobacterium abcessus (MaPPAT, PDB ID: 5O08) and Pseudomonas aeruginosa (PaPPAT, PDB ID: 5TS2 Therefore, structure of enzyme, PPAT must be determined from the bacterium against whom specific drug has to be designed |
| 487 | 3k2c | - | https://www.biorxiv.org/content/biorxiv/early/2019/09/05/758029/DC1/embed/media-... | Supplementary material to GISA: Using Gauss Integrals to identify rare conformations in protein structures | 2019 | C Grnbk, T Hamelryck, P Rgen - 2019 - biorxiv.org | The rar2 scoring method scans for structures having a distribution of words significantly different from that found in the old, here set to 7 ngstrm; the E chain of the 2er7 structure is disqualified for this reason, but 7> means that in the PDB -file the chain id was left blank 14 |
| 488 | 3oa1 | - | https://www.sciencedirect.com/science/article/pii/S1879625718301743 | Status of antiviral therapeutics against rabies virus and related emerging lyssaviruses | 2019 | V Du Pont, RK Plemper, MJ Schnell- Current opinion in virology, 2019 - Elsevier | RABV drug profiles, past efforts to address the problem and inhibitor candidates identified, and examine how the rapidly expanding structural insight into RABV protein organization has illuminated novel druggable target candidates ... The solved crystal structure for the N0 binding domain is depicted in teal (PDB 3OA1). The solved crystal structure for the dimerization domain is depicted in green and pink with both top and side views... |
| 489 | 5elo | 6c86, 5vl1, 6aqg | https://onlinelibrary.wiley.com/doi/abs/10.1002/prot.25699 | Side chain rotameric changes and backbone dynamics enable specific cladosporin binding in Plasmodium falciparum lysyltRNA synthetase | 2019 | J ChhibberGoel, A Sharma- Proteins: Structure, Function, and, 2019 - Wiley Online Library | ( PDB : apo 6C86, holo 5ELO ) and M. ulcerans (MuKRS) ( PDB : apo 5VL1, holo re-arrangements and are noted as 1 to 4 for all the four PDB data sets (Table 1 and Fig. 1). In based on structural analyses. Our analyses also provide a platform for structure -guided |
| 490 | 6d6j | 3oj7 | https://pubs.acs.org/doi/abs/10.1021/acs.jcim.9b00407 | Upgrading and Validation of the AMBER Force Field for Histidine and Cysteine Zinc (II)-Binding Residues in Sites with Four Protein Ligands | 2019 | M Macchiagodena, M Pagliai, C Andreini- Journal of chemical, 2019 - ACS Publications | quantum mechanical calculations on a training set of high-quality protein structures , encompassing the in the catalytic reaction of enzymes, by stabilizing the tertiary/quaternary structure of a cells.(5,7) The high thermodynamic stability of the tetrahedral zinc(II) structural sites in |
| 491 | 3u0d | - | http://www.jbc.org/content/294/51/19523.short | The structure of the bacterial ironcatecholate transporter Fiu suggests that it imports substrates via a two-step mechanism | 2019 | R Grinter, T Lithgow- Journal of Biological Chemistry, 2019 - ASBMB | TBDTs are highly divergent in sequence but share a common structural architecture , consisting of a 22 The structure of Fiu consists of a 22-stranded transmembrane -barrel characteristic of the DALI web server (37) identified PiuA from Acinetobacter baumannii ( PDB code 5FP1 |
| 492 | 3p0x | - | https://www.nature.com/articles/s41467-019-12614-7 | Acetyl-CoA-mediated activation of Mycobacterium tuberculosis isocitrate lyase 2 | 2019 | RP Bhusal, W Jiao, BXC Kwai, J Reynisson- Nature, 2019 - nature.com | The structural resemblance of the Mtb ICL2 C-terminal domain to members of the GNAT observed in crystal structures of isocitrate-bound ICL1 from Brucella melitensis (Bm ICL1, PDB 3P0X ) of the active site loop are more similar to that found in the crystal structure of substrate |
| 493 | 4g7f | - | http://repositorioinstitucional.buap.mx/handle/20.500.12371/4621 | Caracterizacin de la respuesta inmunolgica en el modelo murino inmunizado con la rTcENo por va subcutnea | 2019 | M Gutirrez Soto - 2019 - repositorioinstitucional.buap.mx | Agarosa NTD Enfermedades Tropicales Desatendidas OMS Organizacin Mundial de la Salud ONU Organizacin de las Naciones Unidas OPS Organizacin Panamericana de la Salud PBS Buffer salino de fosfatos PBS-T Buffer salino de fosfatos-Tween 20 PDB Banco de |
| 494 | 3nwo | - | https://arts.units.it/handle/11368/2938808 | Integration of bioinformatics analysis and experimental biocatalysis for a comprehensive approach to the synthesis of renewable polyesters | 2019 | M CESPUGLI - 2019 - arts.units.it | the structural features of a dataset of serine hydrolases, where cutinases play a central role enzyme structure , and the catalytic triad is represented by Ser105, Asp187 and His224. The This molecular architecture is responsible for the reduction of molecular oxygen by the |
| 495 | 4g67 | 4f3n | https://www.degruyter.com/view/j/bchm.2019.400.issue-11/hsz-2019-0182/hsz-2019-0... | Exceptionally versatilearginine in bacterial post-translational protein modifications | 2019 | J Lassak, F Koller, R Krafczyk, W Volkwein- Biological chemistry, 2019 - degruyter.com | Post-translational modifications (PTM) are the evolutionary solution to challenge and extend the boundaries of genetically predetermined proteomic diversity. As PTMs are highly dynamic, they also hold an enormous regulatory potential. The Mitochondrial Dysfunction protein A (MidA), a PRMT from Dictyostelium discoideum shows structural similarities to the putative protein Q6N1P6 (PDB: 1ZKD) of Rhodopseudomonas palustris and two other hypotheticals (PDB: 4F3N, 4G67) (Baugh et al., 2013) from Burkholderia |
| 496 | 5vmk | 4eqy | https://discovery.ucl.ac.uk/id/eprint/10080778/ | Mechanistic characterisation and inhibitor identification of Mycobacterium tuberculosis bifunctional N-acetyltransferase/uridylyltransferase GlmU | 2019 | PD Craggs - 2019 - discovery.ucl.ac.uk | that has contributed to the success of this pathogenic over the last thousand years. Peptidoglycan is a unique and essential structural element that provides much of the Structure of UDP-GlcN Table 7. Published GlmU structures in the Protein Data Bank ( pdb ) ....70 |
| 497 | 4odj | - | https://www.ncbi.nlm.nih.gov/pmc/articles/pmc6794121/ | Genomewide analysis of mode of action of the S-adenosylmethionine analogue sinefungin in leishmania infantum | 2019 | A Bhattacharya, M Sharma, C Pakkinathan, BP Rosen- Msystems, 2019 - ncbi.nlm.nih.gov | C (B) The human LCMT1-PP2AC structure is presented SNF is a structural analogue of S-adenosylmethionine (AdoMet), a key methyl group donor to a |
| 498 | 5i7w | - | https://www.rug.nl/research/portal/files/79350072/Chapter_1.pdf | Omega transaminases: discovery, characterization and engineering | 2019 | CM Palacio - 2019 - rug.nl | (7), who grouped the enzymes in superfamilies by structural similarities and named the superfamilies after the PLP enzyme of which the crystal structure was determined first. The PLP fold-type classification system of Grishin et al Brucella suis, pdb 5I7W ) |
| 499 | 3mx6 | - | https://www.sciencedirect.com/science/article/pii/S0141813019301175 | Discovery of a new class of type 1 methionine aminopeptidases that have relaxed substrate specificity | 2019 | SC Bala, N Haque, V Pillalamarri, R Reddi- International journal of, 2019 - Elsevier | 3MX6 , R. prowazekii, 99% (C), 1% (L) Based on this analysis, MetAP1n has different active site architecture and hence has a substrate preference for leucine in addition 3c. Column 2 describes the result analysis of the HSSP file associated with EcMetAP1a structure ( PDB : 1C21 |
| 500 | 3tde | 3rv2, 3s82, 3iml | https://uknowledge.uky.edu/pharmacy_etds/106/ | Toward an Enzyme-coupled, Bioorthogonal Platform for Methyltransferases: Probing the Specificity of Methionine Adenosyltransferases | 2019 | TD Huber - 2019 - uknowledge.uky.edu | 4.4.5 Protein crystallization, data collection, and structure refinement ..... 105 reported similar promiscuity for the archael Sulfolobus solfataricus MAT (sMAT) and, notably, the corresponding first structural elucidation for a thermostable MAT (sMAT, PDB ID 4HPV) |
| 501 | 3ief | 3m4s, 3mqw, 3m1x | https://repositorioinstitucionaluacm.mx/jspui/bitstream/123456789/86/3/Alma%20Ma... | Caracterizacin de la protena TV-PSP1 y su posible participacin en la degradacin del RNAm de tvcp39 en Trichomonas vaginalis | 2019 | AML Villalobos Osnaya - 2019 - repositorioinstitucionaluacm.mx | Tabla 4. Expresin de molculas en presencia y ausencia de Fe2+24 Tabla 5. Cdigos de PDB de protenas cristalizadas de la familia PSP26 structure of Tv-PSP1 with a molecular weight of 40.5 kDa. The secondary structure -- The table actually has an error for the 3ief organism :P |
| 502 | 3k2c | - | https://www.sciencedirect.com/science/article/pii/S016158901930197X | The Schistosoma mansoni cyclophilin A epitope 107-121 induces a protective immune response against schistosomiasis | 2019 | TT de Melo, MM Mendes, CC Alves, GB Carvalho- Molecular, 2019 - Elsevier | The resulting structure was predicted using six templates (4I9Y: e3 sumo-protein ligase Cyclophilin from Homo sapiens, variant A; 1IHG: bovine cyclophilin 40, 3K2C : peptidyl-prolyl cuniculi; 1XO7: Cyclophilin from Trypanosoma cruzithe bovine Cyclophilin 40 ( PDB code: c1ihgA |
| 503 | 4fi5 | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6913923/ | Identification and validation of specific B-cell epitopes of hantaviruses associated to hemorrhagic fever and renal syndrome | 2019 | F de Paiva Conte, BC Tinoco, TS Chaves- PLoS Neglected, 2019 - ncbi.nlm.nih.gov | 1) was performed against the expasy SWISS-MODEL template server [26][2][2]. Three structures were selected ( PDB ID: 5E04, 5FSG, 4FI5 ) with the The lowest energy model was selected using PyMOL Version 1.8 and your 3D structure evaluated with Verify 3D [29, 30 |
| 504 | 3k9w | - | https://www.sciencedirect.com/science/article/pii/S1570963919300469 | Structural and binding studies of phosphopantetheine adenylyl transferase from Acinetobacter baumannii | 2019 | A Gupta, PK Singh, N Iqbal, P Sharma- et Biophysica Acta (BBA, 2019 - Elsevier | PDB ID: 3ND5; 12), HpPPAT ( PDB ID: 3NV7; 13), BpPPAT ( PDB ID: 3K9W ; 14), CbPPAT ( PDB ID: 4F3R; unpublished), PaPPAT ( PDB ID: 3X1J; 15) and MaPPAT ( PDB ID: 5O06 As indicated by the structure of AbPPAT with CoA ( PDB ID: 5YH7), the ligand binding cleft |
| 505 | 2kn9 | - | https://www.ijper.org/sites/default/files/IndJPhaEdRes_53_2s-143.pdf | Structure Based Computational Exploration of Beilschmiedia Compounds with Selected Targets against Multidrug-Resistant Mycobacterium tuberculosis | 2019 | M Yasir, P Singh, S Chohan, R Shrivastava- INDIAN JOURNAL OF, 2019 - ijper.org | Protein Name PDB - ID Binding Energy (kcal/mol) Antigen 85C 1dqz -3.34 Cytochrome P450 Crystal structure of 3-bromopyruvate modified isocitrate lyase (icl) 1f8m -2.09 EmbR 2ff4 -4.38 Hydroxymycolate synthase MmaA4 2fk7 - Zinc-substituted rubredoxin B 2kn9 -3.46 Cell |
| 506 | 2kok | - | https://royalsocietypublishing.org/doi/abs/10.1098/rsfs.2019.0003 | A deep learning approach to the structural analysis of proteins | 2019 | M Giulini, R Potestio- Interface focus, 2019 - royalsocietypublishing.org | Second, we show that the application of a simple, standard and computationally not expensive DL architecture to the selected features gives satisfactory results, suggesting that The raw data employed in the present work, including PDB files, protein structure datasets, CNN ... Eigenvalues associated with 2KOK, 2YQD, and 1MEK were predicted with reasonable accuracy, the overall average MAPE being 30.7, 35.5 and 48.3, respectively. |
| 507 | 3i3r | - | https://scripts.iucr.org/cgi-bin/paper?ud5007 | Crystal structures of the closed form of Mycobacterium tuberculosis dihydrofolate reductase in complex with dihydrofolate and antifolates | 2019 | JA Ribeiro, SM Chavez-Pacheco- Section D: Structural, 2019 - scripts.iucr.org | mode and protein conformation, we solved the structure of the MtDHFRNADPHDIA ternary complex and compared it with the structure of the of MtDHFRNADPHPMX (yellow) and the B. bovis DHFR domain in complex with NADPH and PMX ( PDB entry 3i3r ; Begley et |
| 508 | 3k5p | - | https://pubs.acs.org/doi/abs/10.1021/acs.biochem.8b00990 | 3-Phosphoglycerate Transhydrogenation Instead of Dehydrogenation Alleviates the Redox State Dependency of Yeast de Novo l-Serine Synthesis | 2019 | N Paczia, J Becker-Kettern, JF Conrotte- Biochemistry, 2019 - ACS Publications | Structural Biology Unit, CIC bioGUNE Technological Park of Bizkaia, 48160 Derio , Vizcaya , Spain. IKERBASQUE, Basque Foundation for Here, we provide a detailed biochemical and sequence structure relationship characterization of the yeast PHGDH homologues |
| 509 | 3ix6 | - | https://www.nature.com/articles/s41598-019-48940-5 | Analysis of mutations leading to para-aminosalicylic acid resistance in Mycobacterium tuberculosis | 2019 | B Pandey, S Grover, J Kaur, A Grover- Scientific reports, 2019 - nature.com | crystal structures of the ThyA enzyme in Brucella melitensis (PDBID: 3IX6 ), M. tuberculosis 3QJ7) 20 , Enterococcus faecalis ( PDB IF: 6QYA), and Escherichia coli ( PDB ID: 1AXW Comparative analysis of the binding free energy, secondary structure elements, and free energy |
| 510 | 3oj6 | 6cuq, 4o3v | https://www.biorxiv.org/content/10.1101/673897v1.abstract | Combining statistical and neural network approaches to derive energy functions for completely flexible protein backbone design | 2019 | B Huang, Y Xu, H Liu- bioRxiv, 2019 - biorxiv.org | To design a backbone, an intended framework is specified first. This framework defines at a very coarse level the intended backbone architecture , including the numbers For each native structure with the given PDB ID, results of four simulations are plotted in different |
| 511 | 3ixc | - | https://repository.kaust.edu.sa/handle/10754/652899 | Activity Assessment of a Halophilic -carbonic Anhydrase from the Red Sea Brine Pool Discovery Deep | 2019 | A Vancea - 2019 - repository.kaust.edu.sa | 25 CA_D 3R1W 3TIO 2FKO 3R3R 3IXC 3VNP 1XHD 4N27 1QRG 3KWC Figure 7: Structural homology study - structural overlay of CA_D monomer with reported PDB structures Table 2: List of the PDB structure used in the structure homology study together with the organism |
| 512 | 3ixc | - | https://link.springer.com/article/10.1007/s10534-019-00190-8 | Molecular structure of thermostable and zinc-ion-binding -class carbonic anhydrases | 2019 | W Wang, Y Zhang, L Wang, Q Jing, X Wang, X Xi- BioMetals, 2019 - Springer | are displayed as cartoon diagrams with different colors and are labelled with their respective PDB codes using -TtCA 169 , the 1011 loop is almost the same as 1V67, 1XHD, 2FKO, 3IXC , 4MFG, and However, in the structure of -TtCA 169 , half of the C-terminal -helix is |
| 513 | 4hvt | - | https://pubs.acs.org/doi/abs/10.1021/acs.biochem.9b00031 | Crystal Structure and Conformational Dynamics of Pyrococcus furiosus Prolyl Oligopeptidase | 2019 | K Ellis-Guardiola, H Rui, RL Beckner, P Srivastava- Biochemistry, 2019 - ACS Publications | Crystal Structure and Conformational Dynamics of Pyrococcus furiosus Prolyl Oligopeptidase While extensive structural characterization of bacterial and mammalian POPs has been performed, no structures for archaeal POPs have been reported |
| 514 | 6d9y | 6d9n | http://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&auth... | Protein secondary structure online server predictive evaluation | 2019 | - Chinese Journal of Bioinformatics, 2019 - search.ebscohost.com | 1 SPIDER Fig.1 Main structure of SPIDER 2.1 |
| 515 | 5i0p | - | https://ecommons.cornell.edu/handle/1813/70073 | STRUCTURE AND FUNCTION OF THE PALMITOYLTRANSFERASE DHHC20 AND THE ACYL COA HYDROLASE MBLAC2 | 2019 | MIP Malgapo - 2019 - ecommons.cornell.edu | crystals ..... 43 The overall structure of hDHHC20 and zfDHHC15 is similar to what was predicted for DHHC enzymes .... 44 Two zinc ions serve a structural function in the cysteine-rich domain of DHHC20 ..... 44 |
| 516 | 3men | - | https://www.degruyter.com/view/j/psr.2019.4.issue-10/psr-2019-0066/psr-2019-0066... | Combined approach of homology modeling, molecular dynamics, and docking: computer-aided drug discovery | 2019 | V Chahal, S Nirwan, R Kakkar- Physical Sciences Reviews, 2019 - degruyter.com | Figure 2: Steps involved in homology modeling for 3D structure prediction sequences of proteins with known 3D structures available in various depositories such as PDB , using the In some cases, a single template is not enough to provide the complete structural information ... This catalytic domain was modeled using the I-TASSER server [98] by exploiting the solved crystal structures of some HDAC proteins having structural identities (2VCG (37%), 1ZZ0 (37%), 1C3P (29%), 3MEN (36%), 3COY (47%), |
| 517 | 5vcu | - | http://www.japsonline.com/admin/php/uploads/2894_pdf.pdf | In-silico study of flavonoids from Cassia tora as potential anti-psoriatic agent | 2019 | I Akachukwu, EE Amara- Journal of Applied Pharmaceutical, 2019 - japsonline.com | 4; CCS ( PDB 5QC5) cathepsin S; JAK-3 ( PDB 5TTS) Janus kinase; RAC-1 ( PDB 5VCU ) Ras-related a vital structural requirement for strong binding with the target proteins The validity of the suggested structure - activity relationship is predicated on the observed reduction of |
| 518 | 3sbx | - | http://amsdottorato.unibo.it/8793/ | Atypical LONELY GUY protein in Bordetella pertussis synthetizes a cytokinin-like compound negatively related to oxidative stress | 2019 | F Moramarco - 2019 - amsdottorato.unibo.it | BP1253 and LOGs, while Cluster omega to realize amino acid sequence alignment with specific type-I and type-II LOGs. The structural analysis were performed through PDB Viewer, either to develop the modeling of BP1253 that to determinate the coordinates of ... Characteristic of this M. marinum protein with PDB ID 3SBX is that it was crystallized in complex with AMP |
| 519 | 3i44 | - | https://journals.plos.org/plosone/article/file?type=printable&id=10.1371/journal... | Understanding the impacts of missense mutations on structures and functions of human cancer-related genes: A preliminary computational analysis of the | 2019 | S Malhotra, AF Alsulami, Y Heiyun, BM Ochoa, H Jubb- PloS one, 2019 - journals.plos.org | We modeled the structure the transmembrane domain and the missing regions between the kinase domain and the transmembrane residue range: 191239, using ( PDB IDs: 1H4I, 3I44 , and 1H4J) as We then mapped the mutation data on to the modeled structure (Fig 6A) |
| 520 | 4nbr | - | https://academic.oup.com/bioinformatics/advance-article-abstract/doi/10.1093/bio... | SCOT: Rethinking the Classification of Secondary Structure Elements | 2019 | T Brinkjost, C Ehrt, O Koch, P Mutzel- Bioinformatics, 2019 - academic.oup.com | -bulge which leads to a kinked (highlighted in green) -helical structure in 4nbr @ pdb (chain A for SCOT and SHAFT for the structure pair 4k20@ pdb and 5cna@ pdb results from based assignment methods except for SHAFT are the most robust ones regarding structure quality |
| 521 | 6omz | - | https://www.teses.usp.br/teses/disponiveis/76/76132/tde-08052020-092357/en.php | Estudos estruturais e descoberta de ligantes da enzima diidropteroato sintase de Xanthomonas albilineans para o combate da escaldadura das folhas | 2019 | AA Oliveira - teses.usp.br | product) and v. Screening, identification, validation and structural detailing of complexed receptor target structure (SBDD) and the fragment (FBDD) to be applied for tularensis ( PDB 3MCM), Coxiella burnetii ( PDB 3TR9), Mycobacterium smegmathis ( PDB 6OMZ ), Vibrio fischer |
| 522 | 6mfk | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/pro.3793 | Structural and functional characterization of three Type B and C chloramphenicol acetyltransferases from Vibrio species | 2019 | A Alcala, G Ramirez, A Solis, Y Kim, K Tan- Protein, 2019 - Wiley Online Library | from P. aeruginosa ( PDB IDs: 1XAT, 2XAT7) and E. anophelis ( PDB ID: 6MFK ). Known SAT 1(A)]. When we compared our structures of the Vibrio proteins with CATs and SATs from the PDB , we found the The AfCAT structure had |
| 523 | 3quv | - | https://www.biorxiv.org/content/10.1101/564013v2.abstract | Fragment-based discovery of a new class of inhibitors targeting mycobacterial tRNA modification | 2019 | SE Thomas, AJ Whitehouse, K Brown, JM Belardinelli- bioRxiv, 2019 - biorxiv.org | at 1.67 and 1.48 resolution respectively ( PDB codes 6NW6 & 6NW7). The crystals belong 109 region is largely disordered, with residues 162-177 not clearly visible in the apo structure 115 of a deep trefoil knot architecture , made of three distinct untwisted loop regions |
| 524 | 4o3v | - | https://jcheminf.biomedcentral.com/articles/10.1186/s13321-019-0360-9 | Improved algorithms for quantifying the near symmetry of proteins: complete side chains analysis | 2019 | I Tuvi-Arad, G Alon- Journal of cheminformatics, 2019 - jcheminf.biomedcentral.com | model of allostery (also referred to as the symmetry model) [5]. Synthesizing a symmetric structure requires less is a characteristic of many protein structures [7]. Searching the Research Collaboratory for Structural Bioinformatics Protein Data Bank (RCSB PDB ) [8, 9] for |
| 525 | 6cw5 | - | https://www.sciencedirect.com/science/article/pii/S0141813019319464 | Unraveling structural insights of ribokinase from Leishmania donovani | 2019 | S Gatreddi, V Pillalamarri, D Vasudevan- International journal of, 2019 - Elsevier | Z-score 42.3; rmsd 2.1 for 307 C atoms), C. neoformans ( PDB ID: 6CW5 , Z-score 36.5; rmsd 2.7 for 290 C atoms) and adenosine kinase of A. tumefaciens ( PDB ID: 2RBC of a five amino acid stretch was observed at the two positions in the primary structure of LdRK |
| 526 | 5w25 | - | https://link.springer.com/chapter/10.1007/978-3-030-05282-9_10 | Impact of Target-Based Drug Design in Anti-bacterial Drug Discovery for the Treatment of Tuberculosis | 2019 | AC Pushkaran, R Biswas, CG Mohan- Structural Bioinformatics, 2019 - Springer | Table 3 Crystal structure of the key druggable targets in Mtb. Molecular target. Pathways involved. PDB ID. DprE1. Arabinogalactan biosynthesis AspS. Protein synthesis. 5W25 . Peptide Deformylase. Maturation of nascent polypeptides. 3E3U. DNA Gyrase |
| 527 | 5u29 | - | https://repositorio.ufpb.br/jspui/handle/123456789/15841 | Sntese, elucidao estrutural e estudos in silico de novos compostos 2-amino-tiofnicos imdicos candidatos a frmacos antifngicos, antileishmanicida e | 2019 | ALC Pereira - 2019 - repositorio.ufpb.br | Synthesis, structural elucidation and in silico studies of novel 2-amino- thiopheneic compounds imidic hybrids were synthesized with determined physicochemical characteristics and confirmed structures through 1H CYP51A1 ( PDB id: 1EA1); (B): ESBT-06 e FTAs ( PDB id: 3SFX |
| 528 | 3hhj | 4dyw | http://repositorio.udec.cl/handle/11594/1006 | Asociacin de genes nudA y htrA de Helicobacter pylori con severidad de patologas gstricas, estudio bioinformtico de la protena NudA. | 2019 | PA Lincoir Campos - 2019 - repositorio.udec.cl | Page 1. Universidad de Concepcin Direccin de Postgrado Facultad de Ciencias Biolgicas - Programa de Magister en Ciencias con Mencin en Microbiologa Asociacin de genes nudA y htrA de Helicobacter pylori con severidad de patologas gstricas |
| 529 | 3kre | - | http://www.freepatentsonline.com/y2019/0209499.html | COMPOUNDS WEAKENING SAICAR SYNTHETASE ACTIVITY AND APPLICATIONS | 2019 | W Pan, W Zhu- US Patent App. 16/334,256, 2019 - freepatentsonline.com | 3R9R), Thermotoga maritime (1KUT), Clostridium perfringens (3NUA), Ehrlichiachaffeensis ( 3KRE ), Geobacilluskaustophilus (2YWV basis of the above results, the crystal structure conformations in Saccharormyces cerevisiae ( PDB : 2CNQ) and Escherichia coli ( PDB : 2GQS) |
| 530 | 4pq9 | - | http://www.jbc.org/content/early/2019/09/09/jbc.RA119.010619.short | A subfamily roadmap for functional glycogenomics of the evolutionarily diverse Glycoside Hydrolase Family 16 (GH16) | 2019 | AH Viborg, N Terrapon, V Lombard, G Michel- Journal of Biological, 2019 - ASBMB | by the presence of numerous helical elements on the core -jelly-roll fold, two in the N-terminal region and four in the C- terminal region, most of which are located on the opposite side of the structure from the active A tryptophan (W154 in PDB ID 4PQ9 (unpublished)) present |
| 531 | 4djt | - | https://academic.oup.com/nar/advance-article-abstract/doi/10.1093/nar/gkz478/549... | PatchSearch: a web server for off-target protein identification | 2019 | J Rey, I Rasolohery, P Tuffry, F Guyon- Nucleic acids, 2019 - academic.oup.com | 4djt 22.3 0.376 positive 10.378 The patch was extracted around ADP in the 1lkx myosin structure . Structural similarities between the patch and the entire surface of 40 PDB structures known to be able to interact, ie 'positive', or not, 'negative', with ADP or similar ligands |
| 532 | 3i0p | - | https://link.springer.com/article/10.1007/s00239-018-9884-2 | Gene encoding a novel enzyme of LDH2/MDH2 family is lost in plant and animal genomes during transition to land | 2019 | LV Puzakova, MV Puzakov, AA Soldatov- Journal of molecular evolution, 2019 - Springer | Prediction of structure and properties of the discov- ered enzyme identified the highest homology to 3I0P pro- tein (P Although tertiary struc- ture of 3I0P protein (malate dehydrogenase from Entamoeba histolytica, https ://doi.org/10.2210/pdb3i 0p/ pdb ) and 1V9N |
| 533 | 2klx | - | https://pubs.acs.org/doi/abs/10.1021/acs.jctc.9b00101 | Utility of Covalent Labeling Mass Spectrometry Data in Protein Structure Prediction with Rosetta | 2019 | ML Aprahamian, S Lindert- Journal of Chemical Theory and, 2019 - ACS Publications | like the following: Which amino acid types provide the most useful structural information structures that served as a nonredundant representation of single chain monomers in the PDB the protein set, distributions of the total number of residues, secondary structure content... The six proteins selected from the ab initio set were PDB ID 1tpm, 2klx, 2nc2, 2y4q, 3iql, and... |
| 534 | 3hzu | 3hwi | https://www.nature.com/articles/s41598-019-53069-6 | Mycobacterium tuberculosis CysA2 is a dual sulfurtransferase with activity against thiosulfate and 3-mercaptopyruvate and interacts with mammalian cells | 2019 | AN Meza, CCN Cambui, ACR Moreno, MR Fessel- Scientific reports, 2019 - nature.com | dimensional structures of M. tuberculosis CysA2 ( PDB code 3HIW, yellow), CysA3 ( PDB code 3AAY, red) and SseA ( PDB code 3HZU , blue) Based on the available three-dimensional structure of CysA2, we performed a comparison with putative orthologues studied in the |
| 535 | 2klx | 3hhj, 3fq3 | https://www.sciencedirect.com/science/article/pii/S0888754319304598 | Potential druggable proteins and chimeric vaccine construct prioritization against Brucella melitensis from species core genome data | 2019 | M Aslam, M Shehroz, M Shah, MA Khan, SG Afridi- Genomics, 2019 - Elsevier | The radius of gyration was also predicted to assess the compactness of structure and the Gene symbols, PDB homolog ID's, Protein Names, Model C-score, Template Vs model RMSD BME_RS00875, 2KLX , glutaredoxin 3, 0.89, 2.0 1.6 , 98.718, 2.88, 0.99 (26), 9419.75, 3.27 |
| 536 | 3gqt | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/jhet.3617 | Design, Synthesis, and Biological and In Silico Study of FluorineContaining Quinoline Hybrid Thiosemicarbazide Analogues | 2019 | DB Patel, KD Patel, NP Prajapati- Journal of, 2019 - Wiley Online Library | Thus, design, development, and structure modification existing drugs are necessary with highly selective potency on specific strains Entry, Code no. R 1, R 2, R 3, Product, Yield (%)a a Purified yield. 1, 8a, 4CF 3, 6CF 3, ... Figure 4c describes the interaction details of compounds 8d and 8k with PDB: 3GQT; compound 8d showed four H‐bond interactions |
| 537 | 6axe | 4ex4 | https://aspace.repository.cam.ac.uk/handle/1810/298685 | The glyoxylate shunt as a target for antibacterial intervention in Pseudomonas aeruginosa | 2019 | AC McVey - 2019 - aspace.repository.cam.ac.uk | The structure of MSG from four prokaryotic species has been resolved by X-ray crystallography: E. coli... Mycobacterium marinum (PDB entry 6AXE), and Mycobacterium leprae (PDB entry 4EX4). Also, the E. coli MSG structure has been solved by NMR |
| 538 | 3laa | 3la9 | https://link.springer.com/article/10.1007/s00430-019-00652-3 | Recent advances in the understanding of trimeric autotransporter adhesins | 2019 | AR Kiessling, A Malik, A Goldman- Medical Microbiology and Immunology, 2019 - Springer | ring (Orange) domains. c Top view of Hia BD1( PDB ID:1S7M) rep- resenting tryptophan side chain from each monomer. d Structure of BpaA ( PDB ID: 3LAA ) representing FGG (Violet purple), short neck (Olive), head (Teal), long neck (Blue) domains |
| 539 | 3h7f | - | https://link.springer.com/chapter/10.1007/978-3-030-18375-2_12 | Combinatorial Designing of Novel Lead Molecules Towards the Putative Drug Targets of Extreme Drug-Resistant Mycobacterium tuberculosis: A Future Insight for | 2019 | N Bachappanavar, S Skariyachan- Essentials of Bioinformatics, Volume II, 2019 - Springer | glyoxylate and dicarboxylate. The native structure of serine hydroxymethyltransferase ( PDB ID: 3H7F ) possessed two chains (A and B) with molecular weight of 95226.08 Da and a resolution of 1.5 (R-value free, 0.196) (Fig. 12.2a). Further |
| 540 | 3ido | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/mbo3.753 | The role of the tyrosine kinase Wzc (Sll0923) and the phosphatase Wzb (Slr0328) in the production of extracellular polymeric substances (EPS) by Synechocystis | 2019 | SB Pereira, M Santos, JP Leite, C Flores- , 2019 - Wiley Online Library | We clarified the roles of both proteins through biochemical and structural analysis, pro viding the first A threedimensional protein structure alignment was performed using representative LMWPTP sequences from the eukaryote E. histolytica ( PDB : 3ido ; UniProt:C4LSE7 |
| 541 | 5ve7 | - | https://scripts.iucr.org/cgi-bin/paper?rf5020 | Crystal structure of UDP-glucose pyrophosphorylase from Yersinia pestis, a potential therapeutic target against plague | 2019 | ME Gibbs, GT Lountos, R Gumpena- Section F: Structural, 2019 - scripts.iucr.org | A over 278 aligned residues, 72% sequence identity), Burkholderia ambifaria ( PDB entry 5ve7 ; rmsd of 1.3 A over 275 aligned residues, 52% sequence identity), Helico- bacter pylori ( PDB entry 3juk Figure 1 (a) Stereoview of a cartoon representation of the crystal structure of Y |
| 542 | 5vm1 | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/jobm.201800482 | Heterologous expression and biochemical characterization of a thermostable xylulose kinase from Bacillus coagulans IPE22 | 2019 | Y Zhang, C Zhao, Z Ni, M Shao, M Han- Journal of basic, 2019 - Wiley Online Library | was shown in Figure 1. In the 3D structure modeling analysis, Bc-XK showed the highest sequence identity of 35% with the homologue from Brucella ovis ATCC 25840 ( PDB accession number 5VM1 , DOI: 10.2210/pdb5VM1/ pdb ), the confi- dence and structure coverage values |
| 543 | 5vwm | - | https://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.9b01604 | Discovery of Novel Inhibitors of LpxC Displaying Potent in Vitro Activity against Gram-Negative Bacteria | 2019 | JP Surivet, P Panchaud, JL Specklin- Journal of Medicinal, 2019 - ACS Publications | UDP-3-O-((R)-3-hydroxymyristoyl)-N-glucosamine deacetylase (LpxC) is as an attractive target for the discovery and development of novel antibacterial drugs to address the critical medical need crea... |
| 544 | 3oc6 | 3ico, 3v2i | https://www.mdpi.com/2073-4352/9/11/597 | Carboxylic Ester Hydrolases in Bacteria: Active Site, Structure, Function and Application | 2019 | C Oh, TD Kim, KK Kim- Crystals, 2019 - mdpi.com | In the Protein Data Bank ( PDB ), 136 crystal structures of bacterial CEHs (424 PDB codes) from The // sandwich architecture is most frequently found in CEHs, but 3-solenoid, are widely used in industrial applications, and are the objects of research in structure - or mutation ... 6-phosphogluconolactonases from M. smegmatis (representative PDB code: 3OC6) [140] belonging to group 3-4 CEHs contains His151-Glu149 as a catalytic dyad with nucleophilic water (Figure 3I). |
| 545 | 5vaz | - | https://www.mdpi.com/2079-6382/7/3/72 | DnaG PrimaseA Target for the Development of Novel Antibacterial Agents | 2018 | S Ilic, S Cohen, M Singh, B Tam, A Dayan, B Akabayov- Antibiotics, 2018 - mdpi.com | 3. Structural Features of DnaG Primase: Opportunities for Drug Targeting IDs: 2HAJ, 1T3W [38,41], respectively, S. aureus PDB ID: 2LZN [42], and Vibrio cholera PDB ID: 4IM9 The crystal structure of the complex between the C-terminal part of DnaG (HBD) and the N-terminal |
| 546 | 5cc8 | - | https://etd.auburn.edu/handle/10415/6361 | Transition from classical methods to new strategies: Mechanistic evaluation of inhibitors against Mycobacterium tuberculosis shikimate kinase | 2018 | N Ren Fuanta - 2018 - etd.auburn.edu | of each family. As stated previously, structural information and interactions with substrate(s) or Group Family and members Example Structure Group 1: Protein S/TY kinase/ atypical protein kinase/ lipid kinase/ ATP- grasp Thiamine-monophosphate kinase PDB : 5CC8 (50) |
| 547 | 5jry | - | https://www.sciencedirect.com/science/article/pii/S2001037018301545 | Molecular Mechanisms of Bacterial Bioluminescence | 2018 | E Brodl, A Winkler, P Macheroux- Computational and Structural, 2018 - Elsevier | we also show stick models of the substrate analog (indole-3-acetaldehyde – blue) and the cofactor (NADP+ − grey) in the respective binding sites obtained from the superposition of the LuxC model with indole-3-acetaldehyde dehydrogenase from Pseudomonas syringae (PDB 5IUW) and from the structure of an aldehyde dehydrogenase from Burkholderia multivorans (PDB 5JRY), respectively. |
| 548 | 5eo6 | - | http://search.proquest.com/openview/8ed519e66d770fcd1d89f1dbb2d646ac/1?pq-origsi... | A Molecular, Structural, and Cellular Multiple-Level Study Aimed at Understanding the Unique Reaction Catalyzed by the Last Enzyme in the Heme-Biosynthesis | 2018 | AIC Luna - 2018 - search.proquest.com | Overlay of the structures of a representative heme b-bound chlorite dismutase and solvent This research aimed to understand ChdC function at the molecular, structural , and cellular levels The coproheme-bound ChdC structure revealed a helical-loop that is flexible and moves |
| 549 | 5vnx | 5jay | https://www.nature.com/articles/s41598-018-32905-1 | Riemerella anatipestifer AS87_RS09170 gene is responsible for biotin synthesis, bacterial morphology and virulence | 2018 | X Ren, X Wang, H Shi, X Zhang, Z Chen, KK Malhi- Scientific reports, 2018 - nature.com | 1DJE [30.2% identity]), Burkholderia multivorans ( PDB accession no. 5VNX [28.6% identity]) and Mycobacterium smegmatis ( PDB accession no. 3WY7 [29.9% identity]) 6). WT Yb2 cells were integral with clear structures , and few were undergoing division |
| 550 | 5unb | - | https://pdfs.semanticscholar.org/9d45/bcaa3c016845d28a2001ff2f58c6ca8ea726.pdf | Supplementary materials to PconsC4: fast, free, easy, and accurate contact predictions. | 2018 | M Michel, D Menndez-Hurtado, A Elofsson - 2018 - pdfs.semanticscholar.org | PconsC4 is trained on a set of 2759 proteins culled from PDB using PISCES (Wang and in (Michel et al., 2017) and the 46 proteins from CASP12 with available structures , Table S6 It is pre-trained to predict secondary structure and surface accessibility for each residue (golden |
| 551 | 5woq | - | http://ijiset.com/vol5/v5s3/IJISET_V5_I03_01.pdf | In-Silico Structural & Molecular Characterization Of Clgr From Mycobacterium Tuberculosis | 2018 | YN Joshi, RD Salunkhe - ijiset.com | was obtained through SWISS MODEL server using resolution 1.8 A structure of ClgR from Mycobacterium smegmatis ( PDB Id: 5woq .2.A K, Bordoli L, Kopp J, Schwede T. The SWISSMODEL Workspace: A web-based environment for protein structure homology modelling |
| 552 | 5idv | - | https://www.sciencedirect.com/science/article/pii/S0969212618301710 | Conformational States of ABC Transporter MsbA in a Lipid Environment Investigated by Small-Angle Scattering Using Stealth Carrier Nanodiscs | 2018 | I Josts, J Nitsche, S Maric, HD Mertens, M Moulin- Structure, 2018 - Elsevier | are slightly apart, rather than in contact, as seen in the closed structure (Figure 3 2005) and a single MsbA monomer (Figure 4). We imposed several structural restraints, assuming an overall confirmation as observed for P-glycoprotein (Szewczyk et al., 2015) ( PDB : 4Q9H) and |
| 553 | 4odj | - | https://journals.plos.org/ploscompbiol/article?id=10.1371/journal.pcbi.1006483 | A benchmark driven guide to binding site comparison: An exhaustive evaluation using tailor-made data sets (ProSPECCTs) | 2018 | C Ehrt, T Brinkjost, O Koch- PLoS computational biology, 2018 - journals.plos.org | In parallel with the ever increasing number of available protein structures in the Protein Data Bank ( PDB )[1], various in silico techniques were developed to apply this structural knowledge[2]. In addition to molecular docking, structure -based pharmacophore searches, and |
| 554 | 4lgv | - | http://search.proquest.com/openview/b04b4d65a244a74db03c8611b0eaa999/1?pq-origsi... | Multi-Scale Simulation of Electrostatic Channeling | 2018 | Y Liu - 2018 - search.proquest.com | Figure 2-6 (a) Illustration of the proposed channeling complex using a poly(lysine) bridge as an electrostatic surface between hexokinase (HK; PDB 3VF6) and glucose-6-phosphate dehydrogenase (G6PDH; PDB 4LGV). (b) Experimental reaction scheme used to study electrostatic channeling of the charge intermediate (glucose-6-phosphate) across a cationic peptide bridge. |
| 555 | 3si9 | 3qfe | https://www.sciencedirect.com/science/article/pii/S0300908418301767 | Dihydrodipicolinate synthase is absent in fungi | 2018 | S Desbois, UP John, MA Perugini- Biochimie, 2018 - Elsevier | Bacillus clausii, 3E96, Bartonella henselae, 3SI9 , [41] 2C) compared to the head-to-head architecture observed for bacterial tetramers (Fig. 2B). Recently, a crystal structure of a putative fungal DHDPS ( PDB ID: 3QFE) has been deposited in the Protein Data Bank ( PDB ) (Fig |
| 556 | 6ape | - | http://www.teses.usp.br/teses/disponiveis/76/76132/tde-06062018-092525/en.php | Estudos estruturais e funcionais da enzima N5, N10-metilenotetrahidrofolato-desidrogenase-ciclohidrolase de Xanthomonas albilineans aplicados descoberta de | 2018 | RV Bueno - 2018 - teses.usp.br | The structural , kinetic, and biophysical data obtained in this PhD thesis provide the molecular basis PCR Reao em cadeia da polimerase PDB Protein Data Bank PEG Polietilenoglicol SAR Relaes estrutura-atividade SBVS Structure -Based Virtual Screening |
| 557 | 4odj | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/pro.3545 | CrossStrand Disulfides in the Hydrogen Bonding Site of Antiparallel sheet (aCSDhs): Forbidden Disulfides that are Highly Strained, Easily Broken | 2018 | NL Haworth, MJ Wouters, MO Hunter, L Ma- Protein, 2018 - Wiley Online Library | Examples include interleukin 36 receptor antagonist (PDB: 1md6) and the previously mentioned ML domains. Other aCSDhs span only short segments of sequence straddling a β‐hairpin (PDBs: 5bvw, 3fl7, 1htd, 3ngm, 4odj). |
| 558 | 3gmt | - | https://spiral.imperial.ac.uk/handle/10044/1/70800 | Approaches for studying allostery using network theory | 2018 | M Hodges - 2018 - spiral.imperial.ac.uk | 101 6.9 Optimization of coherent active and allosteric site motion in 3-dimensional structure . . . 102 B.1 DBSCANmethodforclustering a structural basis for allostery based on comparisons of active and inactive structures . The concept of struc |
| 559 | 4wi1 | - | http://csmres.co.uk/cs.public.upd/article-downloads/Drug-targeting-of-one-or-mor... | Drug targeting of one or more aminoacyl-tRNA synthetase in the malaria parasite Plasmodium | 2018 | Y Manickam, R Chaturvedi, P Babbar- Drug Discovery, 2018 - csmres.co.uk | site of Pf-LRScyto effectively and the crystal structure for the editing domain of enzymes with this scaffold is known different inhibitor molecules: halofuginone (HF, yellow PDB ID: 4YDQ), glyburide (violet, PDB ID: 5IFU), TCMDC-124506 (orange, PDB ID: 4WI1 ) and modeled |
| 560 | 3n58 | - | https://www.nature.com/articles/s41598-018-29535-y | Metal-cation regulation of enzyme dynamics is a key factor influencing the activity of S-adenosyl-l-homocysteine hydrolase from Pseudomonas aeruginosa | 2018 | J Czyrko, J Sliwiak, B Imiolczyk, Z Gdaniec- Scientific reports, 2018 - nature.com | Results. Overall structure of PaSAHase. We present four crystal structures of PaSAHase/ligand/ion(s) complexes at resolutions of 1.35 to 1.75 (Supplementary Information Table S1). Two complexes of Zn 2+ -containing PaSAHase |
| 561 | 4xwi | - | https://www.tandfonline.com/doi/abs/10.1080/07391102.2018.1459318 | Towards novel inhibitors against KdsB: A highly specific and selective broad-spectrum bacterial enzyme | 2018 | S Ahmad, S Raza, A Abro, KR Liedl- Biomolecular Structure, 2018 - Taylor & Francis | from Protein Data Bank ( PDB ) with PDB ID, 4FCU (Berman et al., 2006). The protein is present (A. baumannii), 3K8D (E.coli), 4XWI (P. aeruginosa), 3TQD (C. Burnetii), 3QAM (V explicates enzyme structure stability and strong binding affinity of the compound towards the |
| 562 | 3ek1 | - | https://onlinelibrary.wiley.com/doi/abs/10.1111/febs.14497 | A selective determination of the catalytic cysteine pKa of 2cysteine succinic semialdehyde dehydrogenase from Acinetobacter baumannii using burst kinetics and | 2018 | J Phonbuppha, S Maenpuen- The FEBS, 2018 - Wiley Online Library | An AbSSADH homology model was built based on the aldehyde dehydrogenase X-ray structure ( PDB : 3EK1 ) which Based on sequence homology with E. coli GabD for which the structure is known ( PDB :3JZ4), residues Cys75 and |
| 563 | 4hvt | - | https://chemrxiv.org/ndownloader/articles/7053812/versions/1/export_pdf | Pyrococcus furiosus Prolyl Oligopeptidase: A Dynamic Supramolecular Host for Peptidase and Dirhodium Catalysis | 2018 | K Ellis-Guardiola, H Rui, R Beckner, P Srivastava - 2018 - chemrxiv.org | both Pfu POP and the S447C mutant possess a two-domain architecture involving a peptidase domain reported homology model; M. xanthus chain A from 2BKL; R. typhi from 4HVT ; S. Scrofa from 1QFS; H. Page 17 S1). The structure of |
| 564 | 5udf | - | https://www.pnas.org/content/115/31/E7389.short | Insights into bacterial lipoprotein trafficking from a structure of LolA bound to the LolC periplasmic domain | 2018 | E Kaplan, NP Greene, A Crow- Proceedings of the, 2018 - National Acad Sciences | Fig. 4. Structural and bioinformatic evidence that the Hook is conserved among LolC, LolE, and LolF but absent from the wider type VII ABC transporter superfamily. Comparison of the periplasmic domains of A. actinomycetemcomitans MacB (5LIL), Mycobacterium tuberculosis FtsX (4N8N), E. coli LolC (5NAA), and A. baumannii LolF (5UDF, annotated as LolE in the PDB). |
| 565 | 3sbx | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5989583/ | Genomewide characterisation of the genetic diversity of carotenogenesis in bacteria of the order Sphingomonadales | 2018 | S Siddaramappa, V Viswanathan- Microbial, 2018 - ncbi.nlm.nih.gov | using blastp analysis and acquired from GenBank, rast or the Protein Data Bank ( PDB ) http://espript.ibcp.fr/ESPript/ESPript/) to depict similarities and secondary structure information In this context, the structural and functional similarities between different CrtI homologues need |
| 566 | 4w65 | - | https://www.mdpi.com/1420-3049/23/7/1555 | Isolation of -1, 3-Glucanase-Producing Microorganisms from Poria cocos Cultivation Soil via Molecular Biology | 2018 | Q Wu, X Dou, Q Wang, Z Guan, Y Cai, X Liao- Molecules, 2018 - mdpi.com | The glycoside hydrolase -1,3-glucanase, extensively distributed among plants, fungi, and bacteria, acts on 1,3--glucosidic bonds of structural -1,3-glucans to hydrolyze or transfer glycosides [1,2]. Based on the hydrolysis position, -1,3-glucanases are divided into endo-type |
| 567 | 4lc3 | - | https://royalsocietypublishing.org/doi/abs/10.1098/rsob.170248 | Structural and functional studies of Spr1654: an essential aminotransferase in teichoic acid biosynthesis in Streptococcus pneumoniae | 2018 | X Han, R Sun, T Sandalova, A Achour- Open biology, 2018 - royalsocietypublishing.org | The crystal structures of Spr1654 and in complex with PLP and PMP can direct the future rational design of novel therapeutic compounds against S. pneumoniae... The crystal structures were determined by molecular replacement in Phaser [40] using the crystal structure of UDP-4-amino-4-deoxy-l-arabinose-oxoglutarate aminotransferase from Burkholderia cenocepacia (PDB code: 4LC3) as search model. |
| 568 | 4o5o | - | https://pubs.acs.org/doi/abs/10.1021/acs.biochem.7b01186 | Engineering Erg10 Thiolase from Saccharomyces cerevisiae as a Synthetic Toolkit for the Production of Branched-Chain Alcohols | 2018 | P Torres-Salas, V Bernal, F Lopez-Gallego- Biochemistry, 2018 - ACS Publications | Using a combined computational/experimental approach, and guided by structural information, we have studied the potential of thiolases to with novel properties, the naturally occurring metabolism of microorganisms is not always sufficient to obtain any desired structure |
| 569 | 3gvh | - | https://mic.microbiologyresearch.org/content/journal/micro/10.1099/mic.0.000600 | Analysis of the Mycoplasma bovis lactate dehydrogenase reveals typical enzymatic activity despite the presence of an atypical catalytic site motif | 2018 | Y Masukagami, KA Tivendale- , 2018 - mic.microbiologyresearch.org | between MBOVPG45_0326 and the other bac- terial LDHs, and 2230 % identity across the region of align- ment between MBOVPG45_0326 and the other bacterial and parasitic MDHs in the PDB protein structure database 3GVH RCSB PDB Brucella melitensis LDH |
| 570 | 3krb | - | https://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.14667 | Crystal structure of yeast xylose reductase in complex with a novel NADPDTT adduct provides insights into substrate recognition and catalysis | 2018 | B Paidimuddala, SB Mohapatra, SN Gummadi- The FEBS, 2018 - Wiley Online Library | [20, 21] and Giardia lamblia (GlAR; PDB : 3KRB ) homologs [22]. The AKR fold is a namely, hAR bound to D-glyceraldehyde ( PDB : 3V36) and to glucose-6-phosphate ( PDB : 2ACQ) [15, 35] described the enzyme-glyceraldehyde interactions in detail, the structure shows that the |
| 571 | 5b8i | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6127630/ | Wen-Luo-Tong Decoction Attenuates Paclitaxel-Induced Peripheral Neuropathy by Regulating Linoleic Acid and Glycerophospholipid Metabolism Pathways | 2018 | F Wu, W Xu, B Deng, S Liu, C Deng, M Wu- Frontiers in, 2018 - ncbi.nlm.nih.gov | The structures of proteins were obtained from the Protein Data Bank ( PDB , https://www.rcsb.org/). Protein structures not available from PDB was homology modeled by (https://www.swissmodel. expasy.org) docking was carried out with Discovery Studio 3.5 (BIOVIA, USA) Table 6 Results of docking Proteins PDB ID pcat1 5b8i *Template of homology modeling. |
| 572 | 4l82 | - | https://d-nb.info/1169915167/34 | Identification of Biological Sulfonamide Degradation | 2018 | B Ricken - 2018 - d-nb.info | 99 4.3. Identification of enzymes responsible for SMX degradation .....103 4.4. Sulfonamides molecule structure influences biodegradability .....105 pdb|4L82| Putative Oxidoreductase Rickettsia felis |
| 573 | 3kw3 | - | https://gutpathogens.biomedcentral.com/articles/10.1186/s13099-018-0257-6 | Identification of a new alanine racemase in Salmonella Enteritidis and its contribution to pathogenesis | 2018 | S Ray, S Das, PK Panda- Gut pathogens, 2018 - gutpathogens.biomedcentral.com | From I-Tasser and BLAST analyses, SEN4016 (359 amino acid residues) showed significant structural identity of 91% with Chain A, Y274f Alanine Racemase from E. Coli (PDB-ID-4WR3) with an estimated score of 0.97 ± 0.05 and C-score of 1.82. Similarly, SEN3897 having a score of 0.85 ± 0.08 and C score of 1.00 showed 42% identity with Chain A, Alanine Racemase from Bartonella henselae (PDB-ID-3KW3) and SEN1235 with a C score of 1.79 and estimated score of 0.97 ± 0.05 showed 48% identity with chain A of alanine r |
| 574 | 4q4l | - | https://www.sciencedirect.com/science/article/pii/S0022283618302353 | Integrating cross-linking experiments with ab initio protein-protein docking | 2018 | T Vreven, DK Schweppe, JD Chavez, CR Weisbrod- J Mol Biol. 2018 Jun 8;430(12):1814-1828. | For the resulting complex list, we then searched the PDB for unbound structures A method for integrative structure determination of protein-protein complexes 2636. [13] Pons C, D'Abramo M, Svergun DI, Orozco M, Bernad P, Fernandez-Recio J. Structural characterization of |
| 575 | 5unb | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/prot.25423 | Assessment of hard target modeling in CASP12 reveals an emerging role of alignmentbased contact prediction methods | 2018 | LA Abriata, GE Tam, B Monastyrskyy- Proteins: Structure, 2018 - Wiley Online Library | T0878-D1, 18.30, 12.84, 25.44, 344, 0.85, Burkholderia thailandensis, 5unb Panel E shows the structure of the full target T0912, rainbow-colored to highlight the discontinuities of its Target T0866 ( PDB 5uw2, a homohexamer, Figure 2A) was assessed as 1 evaluation unit of the FM |
| 576 | 5upg | - | https://www.sciencedirect.com/science/article/pii/S0141813018328204 | The inhibitory and binding studies of methyl-sulfone hydroxamate based inhibitors against LpxC from drug resistant Moraxella catarrhalis using biophysical | 2018 | A Sharma, V Kumar, S Pratap, P Kumar- International journal of biological, 2018 - Elsevier | Similarly, a crystal structure of LpxC from P. aeruginosa complexed with the LpxC-4 inhibitors (PDB ID: 5UPG) have also shown the interactions of ligand at these two sites. |
| 577 | 3ily | - | https://www.ingentaconnect.com/contentone/ben/cpd/2018/00000024/00000014/art0001... | Virtual Screening Studies for Discovery of Novel Inhibitors of Inflammatory Process Targets | 2018 | MT Scotti, MF Alves- Current, 2018 - ingentaconnect.com | The structure -based pharmacophore models were produced with several inhibitor complexes (3PDC, 31 3ANS, 27 3ANT, 3OTQ, 3KOO, 3ILY , 3I28, 1ZD5 and 1VJ540) from the PDB databank (https://www.rcsb.org/ pdb /) [139-144] |
| 578 | 4dxl | - | https://patents.google.com/patent/US20180271098A1/en | Oxadiazole and phenol derivatives as antibacterial and/or herbicidal agents | 2018 | TJ Hagen, M Thompson, JR Troxell- US Patent App. 15, 2018 - Google Patents | To date, there are 17 crystal structures of six different species of IspE deposited in the PDB with 17 different ligands FIG. 11 . X-Ray Crystal Structure of Mycobacterium abscessus IspE with ATP (red) and CMP (blue) Bound to Active Site; PDBID 4DXL . FIG. 12 |
| 579 | 4ix8 | - | https://www.sciencedirect.com/science/article/pii/S0981942818304790 | Comprehensive genomic analysis of the TYROSINE AMINOTRANSFERASE (TAT) genes in apple (Malus domestica) allows the identification of MdTAT2 conferring | 2018 | H Wang, Q Dong, D Duan, S Zhao, M Li- Plant Physiology and, 2018 - Elsevier | sequence identity for residues 44423), whereas MdTAT3 structure most closely matched that of Leishmania infantum TAT ( PDB ID: 4IX8 .A; RMSD To better understand the gene structure diversity of apple TAT proteins, the intron-exon organization in the coding sequences of |
| 580 | 3rd5 | - | http://search.proquest.com/openview/3456a0f162d24a094672122e01905158/1?pq-origsi... | Mechanistic Studies on the Light-Dependent NADPH: Protochlorophyllide Oxidoreductase and Animal Cryptochromes | 2018 | N Archipowa - 2018 - search.proquest.com | a C15-E-anti-configuration as shown in Figure 1.4A [8]. This is followed by formation. of several thermally activated intermediates comprising structural changes of the POR. Crystal structure of the NB-protein catalytic site ( PDB : 3AEK [32]). The |
| 581 | 4hwg | 5dld | http://www.jbc.org/content/293/26/10119.short | The tetrameric structure of sialic acidsynthesizing UDP-GlcNAc 2-epimerase from Acinetobacter baumannii: A comparative study with human GNE | 2018 | TP Ko, SJ Lai, TJ Hsieh, CS Yang, Y Chen- Journal of Biological Chemistry, 2018 - ASBMB | known for at least 10 species ( PDB codes 1F6D, 1O6C, 1V4V, 3BEO, 3DZC, 3OT5, 4HWG , 4NEQ, 5DLD Structural determination and refinement molecular replacement with the PHENIX AutoMR (24) using the previously published human homologue structure ( PDB code 4ZHT |
| 582 | 4f4h | 5kha | http://www.jbc.org/content/293/19/7397.short | Kinetics and structural features of dimeric glutamine-dependent bacterial NAD+ synthetases suggest evolutionary adaptation to available metabolites | 2018 | ARS Santos, ECM Gerhardt, VR Moure- Journal of Biological, 2018 - ASBMB | Given the availability of a 1.7 resolution structure of dimeric NadE2 Gln from B. thailandensis ( PDB code 4F4H ) obtained by the Burkholderia structome project (21), we used this protein to analyze the structural features of the subgroup of dimeric NadE2 Gln |
| 583 | 2khp | - | http://rave.ohiolink.edu/etdc/view?acc_num=akron1524681449524557 | NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY IN THE STUDY OF PROTEIN-LIGAND INTERACTIONS | 2018 | DL Morris - 2018 - rave.ohiolink.edu | Structures of target proteins were obtained from the Protein Data Bank (PDB). The PBD code for BrmGRX is 2KHP and hGRX1 is 1JHB. |
| 584 | 5idv | - | https://www.sciencedirect.com/science/article/pii/S002228601831439X | Synthesis, spectroscopic properties, crystal structure, antimicrobial properties and Molecular Docking Studies of the complex (1) 3 (C36H24MnN6) 6 (PF6). 0.5 H2O | 2018 | HEL Hamdani, MEL Amane, C Duhayon- Journal of Molecular Structure, 2018 - Elsevier | Docking studies was proceeded by taking the five receptors (The PDB id: 1E15(S 3BU2 (S. saprophiticus), 3GFX (klipsila pnumani), 1BY3 (E. coli) and 5IDV (acinetobacter baumannii determination of complex (1) confirmed the assignments of the structure from spectroscopic data |
| 585 | 4ix8 | - | https://febs.onlinelibrary.wiley.com/doi/abs/10.1002/2211-5463.12441 | Bioinformatic analysis of the fold type I PLPdependent enzymes reveals determinants of reaction specificity in lthreonine aldolase from Aeromonas jandaei | 2018 | K Fesko, D Suplatov, V vedas- FEBS open bio, 2018 - Wiley Online Library | to account for structural and functional variability within a large superfamily. First, comparison of protein structures was implemented to study distant evolutionary relationships because structures are more conserved in evolution than sequences. Table 1. Conserved and FSPs in the aspartate aminotransferase superfamily. Tyrosine aminotransferase 4ix8 D253 |
| 586 | 4qhq | - | https://thesis.library.caltech.edu/10840/ | Structural and Functional Characterization of the Escherichia coli MetNI Methionine Transporter | 2018 | PT Nguyen - 2018 - thesis.library.caltech.edu | PTN participated in soaking experiments for the L-semethionine-bound MetNI structure ( PDB :3TUZ) and manuscript preparation. Page 12. xii transporter architecture and mechanism. Science 16. Oldham ML, Khare D, Quiocho FA, Davidson AL, Chen J. Crystal structure of a |
| 587 | 3iew | - | https://pointloma.whdl.org/sites/default/files/Harper-Synthesis%20and%20Computat... | Synthesis and Computational Analysis of Novel IspF Inhibitors | 2018 | D Harper, M Rouffet, L Votapka- Bulletin of the American, 2018 - pointloma.whdl.org | The crystal structure of IspF was taken from the Protein Data Bank, code 3iew .7 The first As for the protein, the monomer's crystal structure was cleaned and protonated with the H++ webserver (version 3.2).11 The . pdb file was manually edited to correct these protonation states |
| 588 | 4qhq | - | https://tel.archives-ouvertes.fr/tel-02296605/ | Dveloppement d'un alphabet structural intgrant la flexibilit des structures protiques | 2018 | I Sekhi - 2018 - tel.archives-ouvertes.fr | 84 4.2.2 Architecture du site web 2.5 Comparaison de temps d'excution de SAFlex- PDB avant et aprs optimisation ensemble de conformations gomtriques reprsentatif des fragments protiques, appels lettres structurales (LS) , et destines simplifier la structure 3D d |
| 589 | 4q14 | - | https://pubs.acs.org/doi/abs/10.1021/acschembio.8b00404 | Diatom allantoin synthase provides structural insights into natural fusion protein therapeutics | 2018 | J Oh, A Liuzzi, L Ronda, M Marchetti- ACS chemical, 2018 - ACS Publications | Diatom Allantoin Synthase Provides Structural Insights into Natural Fusion Protein Therapeutics The 1.85--resolution crystal structure of allantoin synthase from the diatom Phaeodactylum tricornutum provides a rationale for the domain combinations observed in the metabolic The 1.85-Å-resolution structure of PtAlls was determined by molecular replacement program in PHENIX(55) by using the Urah structure from Brucella melitensis (PDB ID: 4Q14) as a search model. |
| 590 | 4emd | 4ed4, 4dxl | http://commons.lib.niu.edu/handle/10843/21449 | Evaluation of IspE for inhibitor design in the non-mevalonate pathway | 2018 | KB Hoerchler - 2018 - commons.lib.niu.edu | crystal structures were obtained ( PDB : 1UEK, 1OJ4).38,39 IspE possesses structural features Figure 1-5. Crystal Structures of MaIspE The left structure ( PDB : 4EMD ) co-crystallized with CMP and a sulfate ion while the right ( PDB : 4ED4) co-crystallized with ATP.42 |
| 591 | 4whx | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/prot.25477 | The transaminase engineering database (oTAED): a navigation tool in protein sequence and structure space | 2018 | O Bu, PCF Buchholz, M Grff- Proteins: Structure, 2018 - Wiley Online Library | entry 4WHX ) and an amino lyase with activity towards 4-amino-4-deoxychorismate ( PDB entry 2Y4R) [68] as the -TA from Arthrobacter sp. ( PDB entries 5FR9 and 3WWH) which was adapted by John Wiley & Sons, Inc. PROTEINS: Structure , Function, and Bioinformatics |
| 592 | 2lgo | - | https://www.biorxiv.org/content/10.1101/431635v1.abstract | A general-purpose protein design framework based on mining sequence-structure relationships in known protein structures | 2018 | J Zhou, AE Panaitiu, G Grigoryan- bioRxiv, 2018 - biorxiv.org | decompose the target structure to be designed into structural building blocks we call TERMs (tertiary motifs) and use rapid structure search against the Protein Data Bank ( PDB ) to identify sequence patterns associated with each TERM from known protein structures that contain it |
| 593 | 4n5f | - | http://www.jbc.org/content/293/5/1702.short | Structural basis for substrate specificity of methylsuccinyl-CoA dehydrogenase, an unusual member of the acyl-CoA dehydrogenase family | 2018 | T Schwander, R McLean, J Zarzycki, TJ Erb- Journal of Biological, 2018 - ASBMB | The structure was solved using molecular replacement using the Phaser-MR and AutoBuild programs of the Phenix software package (31). The structure of a putative acyl-CoA dehydrogenase (PDB code 4N5F; 26.5% sequence identity) served as a search model for the molecular replacement. |
| 594 | 4ywj | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/prot.25574 | Coil conversion to strand induced by dimerization | 2018 | J Laibe, A Caffrey, M Broutin, S Guiglion- Proteins: Structure, 2018 - Wiley Online Library | CATH: an expanded resource to predict protein function through structure and sequence -strand interfaces, standard - strand interfaces and domains in CATH (based on PDB release: July 01 interface including a salt bridge between E226-A and H232-B ( 4YWJ ) B. Dimorphic |
| 595 | 4wny | - | https://www.sciencedirect.com/science/article/pii/S0065216417300424 | Twenty-Five Years of Investigating the Universal Stress Protein: Function, Structure, and Applications | 2018 | AC Vollmer, SJ Bark- Advances in applied microbiology, 2018 - Elsevier | Since the initial discovery of universal stress protein A (UspA) 25 years ago, remarkable advances in molecular and biochemical technologies have revolutionized our understanding of biology. Many studies using these technologies have focused on characterization of the uspA gene and Usp-type proteins. These studies have identified t... Universal stress protein 4WNY B. pseudomallei Abendroth, Dranow, Lorimer, and Edwards (2008) |
| 596 | 4wi1 | 4olf | https://www.sciencedirect.com/science/article/pii/S1319016418300240 | Inverse docking based screening and identification of protein targets for Cassiarin alkaloids against Plasmodium falciparum | 2018 | A Negi, N Bhandari, BRK Shyamlal- Saudi Pharmaceutical, 2018 - Elsevier | In order, to find the active site on those structure which does not contain co-crystallise ligand, active site finder tool was used to identify the active patches Protein, PDB , Res 4WI1 , 1.65, 1-(4-fluorophenyl)-3-[4-(4-fluorophenyl)-1-methyl-3-(trifluoromethyl)-1H-pyrazol-5-yl]-urea, 0.501 |
| 597 | 3rih | 3uve | https://link.springer.com/article/10.3103/S0027131418050085 | The Role of Charged Residues in the Structural Adaptation of Short-Chain Alcohol Dehydrogenase (SDR) from Thermophilic Organisms to High Temperatures | 2018 | AV Popinako, MY Antonov, EY Bezsudnova- Moscow University, 2018 - Springer | Protein structures from PDB database are marked with asterisk 3RIH (Mycobacterium Abscessus tion involving specific patterns of the distribution of dif- ferent residues in the structure , including their distribu- tion on the solvent-accessible molecular surface and in the protein core |
| 598 | 4wec | - | https://www.sciencedirect.com/science/article/pii/S0045653518315108 | Quantitative proteomic and transcriptional analyses reveal degradation pathway of -hexachlorocyclohexane and the metabolic context in the actinobacterium | 2018 | PE Sineli, HM Herrera, SA Cuozzo, JSD Costa- Chemosphere, 2018 - Elsevier | Template crystal structures , obtained from PDB data bank (RCSB- PDB ), were 3A76 for dehydrochlorinase, 4HZG for haloalkane dehalogenase and 4WEC for short-chain alcohol dehydrogenase. Protein structures were visualized using PyMol |
| 599 | 3qh8 | 3py6, 3py5 | http://www.biochemj.org/content/475/1/261 | An unusual diphosphatase from the PhnP family cleaves reactive FAD photoproducts | 2018 | GAW Beaudoin, Q Li, SD Bruner, AD Hanson- Biochemical Journal, 2018 - biochemj.org | Skip to main content. Main menu. Home; About the Journal: Scope; Editorial Board; Impact & Metrics; Benefits of Publishing; Advertising/Sponsorship; About the Biochemical Society. Current Issue; For Authors: Submit Your Paper; Submission |
| 600 | 3k2h | - | https://onlinelibrary.wiley.com/doi/abs/10.1111/tpj.13983 | Targeting plant DIHYDROFOLATE REDUCTASE with antifolates and mechanisms for genetic resistance | 2018 | MG Corral, J Haywood, LH Stehl, KA Stubbs- The Plant, 2018 - Wiley Online Library | The homology models of A. thaliana DHFR‐TS1 and DHFR‐TS2 were created ab initio based on the structure of the bifunctional DHFR‐TS enzyme from B. bovis (PDB 3K2H; Begley et al., 2011), using the I‐TASSER server (Zhang, 2008). |
| 601 | 4wkw | - | https://pubs.acs.org/doi/abs/10.1021/acsinfecdis.7b00111 | Identification of a Mycothiol-Dependent Nitroreductase from Mycobacterium tuberculosis | 2018 | A Negri, P Javidnia, R Mu, X Zhang- ACS infectious, 2018 - ACS Publications | Compared with published crystal structures of Rv2466c (PDB ID: 4NXI, 4ZIL) and the M. leprae homologue (PDB ID: 4WKW), there were significant conformational changes in one subunit of our structure |
| 602 | 4wxt | - | https://www.sciencedirect.com/science/article/pii/S014181301830610X | Inhibition of thioredoxin A1 from Corynebacterium pseudotuberculosis by polyanions and flavonoids | 2018 | RJ Eberle, LA Kawai, FR de Moraes, D Olivier- International journal of, 2018 - Elsevier | The initial model of the Cp-TrxA1 protein was obtained by homology modeling with the M. avium Trx structure ( PDB : 4WXT ; 50% homology), in order to Structural superposition of the Cp-TrxA1 homology model and the M. avium Trx structure showed a RMSD of 0.188 (Fig |
| 603 | 3o0h | - | https://www.degruyter.com/view/j/zkri.ahead-of-print/zkri-2018-2064/zkri-2018-20... | Sulfur (lone-pair) interactions with FAD in flavoenzymes | 2018 | RFN Silva, ACS Sacco, I Caracelli- Zeitschrift fr, 2018 - degruyter.com | The interactions of π-systems with lone-pairs of electrons are known and have been described in biological systems, involving lone-pairs derived from metals, metalloids, sulphur, oxygen and nitrogen. This study describes a bibliographic survey of the disulphide-bound sulphur(lone-pair) interactions with -systems residing in the flavin ad Also, the S(lp)…π(FAD) interaction in the 1K4Q [64] and 3O0H [65] proteins show the orientation of sulphur-lp to the Ct(U) centroid, F |
| 604 | 5v6d | - | https://papers.ssrn.com/sol3/papers.cfm?abstract_id=3188389 | A Centipede Toxin Family Defines a New Ancient Class of CS Defensins | 2018 | TS Dash, T Shafee, PJ Harvey, C Zhang- Available at SSRN, 2018 - papers.ssrn.com | structure of Sm2 against all structures of proteins contained within the Protein Data Bank ( PDB ) that are composed of more than 30 amino acids Thus, the minimal cysteine motif is by itself sufficient to generate a stable CS structure . Although the 2ds-CS architecture has |
| 605 | 4yk1 | - | http://www.superfri.org/superfri/article/view/171 | High performance computing with coarse grained model of biological macromolecules | 2018 | EA Lubecka, AK Sieradzan, C Czaplewski- Supercomputing, 2018 - superfri.org | The source code in the UNRES package with Fortran 90 has the following directory structure : unres (main program modules, source NucB (110 residues, single chain, PDB code: 5OMT), BID domain of Bep6 (137 residues, single chain, PDB code: 4YK1 ), CDI complex |
| 606 | 5b8i | - | https://journals.asm.org/doi/abs/10.1128/aac.01627-18 | In Vitro and In Vivo Assessment of FK506 Analogs as Novel Antifungal Drug Candidates | 2018 | Y Lee, KT Lee, SJ Lee, JY Beom- Antimicrobial agents, 2018 - Am Soc Microbiol | However, the structure of the fungal ternary complex from Coccidioides immitis has recently been reported ( PDB accession number 5B8I ), which would facilitate the rational design of FK506 analogs that can discriminate human and fungal calcineurins |
| 607 | 3oa3 | 3ndo, 3ngj | https://patents.google.com/patent/US20180340193A1/en | Methods And Microorganisms For The Production Of 1, 3-Butanediol | 2018 | R Mahadevan, A Yakunin, P Gawand- US Patent App. 15, 2018 - Google Patents | 2.4.). In some embodiments, DERA enzymes can be described as class I aldolases that form covalent Schiff base intermediates. In all studied structures , DERA adopts the classical eight-bladed TIM barrel fold. The oligomerisation |
| 608 | 3ijp | - | https://www.nature.com/articles/s41598-018-26291-x | Crystal structure of dihydrodipicolinate reductase (Pa DHDPR) from Paenisporosarcina sp. TG-14: structural basis for NADPH preference as a cofactor | 2018 | CW Lee, SH Park, SG Lee, HH Park, HJ Kim, HJ Park- Scientific reports, 2018 - nature.com | EcDHDPR; UniProtKB: P04036; PDB : 1DRU), B. henselae (BhDHDPR; UniProtKB: Q6G2G3; PDB : 3IJP ), A. variabilis P40110; PDB : 5EER), and M. tuberculosis (MtDHDPR; UniProtKB: P9WP23; PDB : 1YL5 The crystal structure of DPA-bound PaDHDPR was also obtained in the |
| 609 | 3sdo | - | https://www.frontiersin.org/articles/10.3389/fmicb.2018.00231 | Structural and Biochemical Characterization of BdsA from Bacillus subtilis WU-S2B, a Key Enzyme in the 4S Desulfurization Pathway | 2018 | T Su, J Su, S Liu, C Zhang, J He, Y Huang- Frontiers in, 2018 - frontiersin.org | This work combined with our previous structure of DszC provides a systematic structural basis for the The native BdsA structure was resolved by molecular replacement using Phaser from the CCP4 suit of programs (Winn et al., 2011) with LadA ( PDB entry 3B9N) as the |
| 610 | 4zju | - | http://scholarworks.csun.edu/handle/10211.3/200116 | Battling Antibiotic Resistance by Investigation of Acinetobacter baumannii Enoyl Acyl Carrier Protein Reductase | 2018 | C Wong - 2018 - scholarworks.csun.edu | The active site residues of abFabI in green ( PDB ID: 4ZJU , ecFabI in blue ( PDB ID: 5CFZ) and InhA in magenta ( PDB ID: 4TRM) overlay relatively Bacterial Species Year Representative PDB ID FabI homologs are similar in sequence, but the structure of their active sites may |
| 611 | 6c87 | 6byq | https://scripts.iucr.org/cgi-bin/paper?rr5159 | SIMBAD: a sequence-independent molecular-replacement pipeline | 2018 | AJ Simpkin, F Simkovic, JMH Thomas- Section D: Structural, 2018 - scripts.iucr.org | researchers involved. All cases involve the crystallization of a known contaminant. Examples involving the use of SIMBAD for novel structure solution are available elsewhere, such as PDB entries 6byq, 6c87 and 5wol. Cases illustrating |
| 612 | 4zju | - | https://onlinelibrary.wiley.com/doi/abs/10.1111/mmi.13950 | Structure and substrate specificity of ketoacylacyl carrier protein synthase III from Acinetobacter baumannii | 2018 | WC Lee, MC Jeong, Y Lee, C Kwak- Molecular, 2018 - Wiley Online Library | detailed structures of FAS-related proteins from A. baumannii are still lacking except for the unpublished structure of FabI ( PDB ID: 4ZJU ). To our knowledge, the AbKAS III structures KAS III orthologs, whereas only one is found in the A. baumannii genome. Our structure and |
| 613 | 3oks | - | https://link.springer.com/protocol/10.1007/978-1-4939-7366-8_4 | YASARA: A Tool to Obtain Structural Guidance in Biocatalytic Investigations | 2018 | H Land, MS Humble- Protein Engineering, 2018 - Springer | File > Load > yob file from Your working directory. File > Load > Pdb file from internet. To align the structures [31] 1.531. 386 g. 29.8. 3OKS h. 1.702. 717. 27.8 g Monomer. h Crystal structure (444 residues) of a 4-aminobutyrate transaminase from Mycobacterium smegmatis [34] |
| 614 | 5bnt | - | https://scripts.iucr.org/cgi-bin/paper?dp5109 | Structure of aspartate -semialdehyde dehydrogenase from Francisella tularensis | 2018 | NJ Mank, S Pote, KA Majorek, AK Arnette- Section F: Structural, 2018 - scripts.iucr.org | entry 3pzr; Pavlovsky et al., 2012), Pseudomonas aeruginosa ( PDB entry 5bnt ; Seattle Structural N-acetyl- -glutamyl-phosphate reductases (ArgCs), including proteins with known structure : ArgCs from entry 2i3a; Cherney et al., 2007), Salmonella typhi- murium ( PDB entry 2g17 |
| 615 | 3rrp | - | https://www.sciencedirect.com/science/article/pii/S0141022918302370 | Enhancing the thermostability of fumarase C from Corynebacterium glutamicum via molecular modification | 2018 | L Lin, Y Wang, M Wu, L Zhu, L Yang, J Lin- Enzyme and microbial, 2018 - Elsevier | The modeled structure of cgFumC was completed through homology modeling with the Swiss-Model server by using the crystal structure of the fumarate hydratase Fum ( PDB ID: 3RRP ) from Mycobacterium abscessus as a template, which shares a 75.76% sequence |
| 616 | 5ify | - | https://www.sciencedirect.com/science/article/pii/S007961071830172X | A structural and functional perspective on the enzymes of Mycobacterium tuberculosis involved in the L-rhamnose biosynthesis pathway | 2018 | DK Dhaked, MB Divya, L Guruprasad- Progress in Biophysics and, 2018 - Elsevier | Some representative crystal structures of RmlA-D were retrieved from PDB and were compared with the models constructed The structure superposition of some known RmlAs (PDB_IDs: 1FXO, 1IIM, 1H5T, 3PKP, 5IFY and 6B5E) revealed their highly similar structures |
| 617 | 4maq | - | http://www.biochemsoctrans.org/content/early/2018/02/26/BST20170518.abstract | The fumarylacetoacetate hydrolase (FAH) superfamily of enzymes: multifunctional enzymes from microbes to mitochondria | 2018 | AKH Weiss, JR Loeffler, KR Liedl- Biochemical Society, 2018 - biochemsoctrans.org | Skip to main content. Main menu. Home; About the Journal: Scope; Editorial Board; Benefits of Publishing; Impact & Metrics; Advertising/Sponsorship; About the Biochemical Society. Current Issue; For Authors: Submit Your Paper; Submission |
| 618 | 5u9p | 3ftp | https://pdfs.semanticscholar.org/eba1/31d1aecdd33eafa513c4bec6c3ec37d01b5b.pdf | Electrical Supporting information | 2018 | F Sha, Y Zheng, J Chen, K Chen, F Cao, M Yan - pdfs.semanticscholar.org | Entry Enzyme GenBank accession no. Amino acid identities with PspPDH [%] Template PDB code TM- scorea Gbind [kcal mol-1] 23 PhpPDH WP_045028254 41.53 4z9y 0.90 -5.71 1.96 24 DfPDH WP_050774712 31.98 5u9p 0.90 -11.90 2.01 |
| 619 | 3o0m | - | http://search.proquest.com/openview/769ccf38b4f4380a7bc1930f51547727/1?pq-origsi... | Characterization of Mycobacterial Flap Endonuclease FenA and RNA Helicase HelY | 2018 | MLL Uson - 2018 - search.proquest.com | There, she focused on the detection of circulating tumor cells and structural characterization of EphA3, a 122 Figure 4.3 Manganese ions in the FenA active site ..... 126 Figure 4.4 Active site architecture and structure -guided mutagenesis |
| 620 | 5unb | - | https://www.biorxiv.org/content/early/2018/11/06/463554.abstract | NEPRE: a Scoring Function for Protein Structures based on Neighbourhood Preference | 2018 | S Liu, X Xiang- bioRxiv, 2018 - biorxiv.org | Based on the testing results and the comparison with several other structure assessment methods, we report that the neighborhood structural correctness. MATERIALS AND METHODS composed of 14,647 PDB structures , which were selected from the NCBI VAST (the vector |
| 621 | 3gtd | 3tv2, 3rd8 | http://www.teses.usp.br/teses/disponiveis/60/60136/tde-23052019-093047/en.php | Mapeamento das bases estruturais e suas correlaes com patogenias humanas associadas mutaes na fumarase humana | 2018 | MAA Aleixo - 2018 - teses.usp.br | HsFH crystal structure was solved at 1.8 resolution and identified HEPES molecules complexed with the FumC (1YFE);Saccharomyces cerevisiae (strain ATCC 204508 / S288c) FH (1YFM); Rickettsia prowazekii FH ( 3GTD ), Mycobacterium tuberculosis PDB Protein Data Bank |
| 622 | 3sth | - | http://dalspace.library.dal.ca/handle/10222/73554 | Molecular Adaptations in Extremely Halophilic Protists | 2018 | T Harding - 2018 - dalspace.library.dal.ca | proteins compared to the templates used to model the tertiary structures , as a of proteins and alteration of transcriptional programs, leading to modification of cell structure properties like open reading-frame OTU operational taxonomic unit P2XR P2X receptor PDB Protein Data |
| 623 | 3qh4 | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/ddr.21468 | Microbial esterases and ester prodrugs: An unlikely marriage for combating antibiotic resistance | 2018 | EM Larsen, RJ Johnson- Drug development research, 2018 - Wiley Online Library | Bacterial esterase structure and function The bacterial esterase, LipW from M. tuberculosis ( PDB ID: 3QH4 ) is shown as an example with its sheets in tan, its helices in purple, and its catalytic triad in sticks and labeled |
| 624 | 5unb | - | https://www.biorxiv.org/content/early/2018/12/01/480194.abstract | Universal architectural concepts underlying protein folding patterns | 2018 | A Lesk, R Subramanian, L Allison, D Abramson- bioRxiv, 2018 - biorxiv.org | to give proteins their intricate three-dimensional shapes and folding patterns (tertiary structure ) Unravelling protein architecture and discovering the relationship among these three major levels of of protein folding patterns have revealed recurrent themes at all structural levels (2 |
| 625 | 2lwk | - | https://www.sciencedirect.com/science/article/pii/S0168945218302693 | RNA on the move: the plasmodesmata perspective | 2018 | BC Reagan, EE Ganusov, JC Fernandez, TN McCray- Plant Science, 2018 - Elsevier | While this synthetic RNA consists of only 32 nucleotides, it has a corresponding radius of gyration of 15.48 Å (1.548 nm) when bound to the small molecule DPQ (6,7-dimethoxy-2-(piperazin-1-yl)quinazolin-4-amine) (PDB ID: 2LWK) |
| 626 | 3i4e | - | http://www.jbc.org/content/early/2018/07/20/jbc.RA118.004514.short | Gluconeogenic precursor availability regulates flux through the glyoxylate shunt in Pseudomonas aeruginosa | 2018 | A Crousilles, SK Dolan, P Brear, DY Chirgadze- Journal of Biological, 2018 - ASBMB | domain of each chain (Figure S7), suggesting that catalysis is accompanied by structural rearrangements Comparison of the P. aeruginosa IDH active site architecture with that of ICD in the The structure ( PDB ; 5M2E), solved to 2.7 resolution, was very similar to that reported for |
| 627 | 3uam | - | http://www.ir.juit.ac.in:8080/jspui/bitstream/123456789/16581/1/SP13412_RADHIKA%... | Computational Studies on Substrate Specificity in Lytic Polysaccharide Monooxygenases | 2018 | R Arora, RM Yennamalli - 2018 - ir.juit.ac.in | 4ALS, 4ALT), Burkholderia pseudomallei CBM33 ( PDB ID: 3UAM ) [10], Bacillus coelicolor CBM2 ( PDB ID: 4OY7), Cellvibrio japonicas CBP33 ( PDB ID: 5FJQ). Page 17. 3 1.5 LPMO and substrate interactions Due to the binding of copper LPMO structure gets stabilized |
| 628 | 3qxz | 3oc7, 4qtp, 3swx, 3qk8, 3qre | https://www.sciencedirect.com/science/article/pii/S1476927117300105 | Similarity/dissimilarity analysis of protein structures based on Markov random fields | 2018 | J Wu, T Zhou, J Tao, Y Hai, F Ye, X Liu, Q Dai- Computational biology and, 2018 - Elsevier | Recently, the growth of the Protein Data Bank ( PDB ) (Berman et al., 2000) has been accelerated by a large scale As a result, fast and efficient algorithms for protein structure comparison have become more important to take advantage of the huge amount of structural data |
| 629 | 4xk1 | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6043687/ | Structural analysis of phosphoserine aminotransferase (isoform 1) from Arabidopsis thalianathe enzyme involved in the phosphorylated pathway of serine | 2018 | B Sekula, M Ruszkowski, Z Dauter- Frontiers in Plant Science, 2018 - ncbi.nlm.nih.gov | identity (Supplementary Figure S2), which are structurally very similar to AtPSAT1: PaPSAT ( PDB ID: 4xk1 , rmsd = 1.0 For example, in the structure of HsPSAT ( PDB ID: 3e77), the N-terminal coil at first look Residues 816 visible in the structure came from the expression tag |
| 630 | 4g6c | 3laa | https://aip.scitation.org/doi/abs/10.1063/1.5048469 | Blind prediction of protein B-factor and flexibility | 2018 | D Bramer, GW Wei- The Journal of chemical physics, 2018 - aip.scitation.org | MENU. SIGN IN. Sign in/Register. Enter words / phrases / DOI / ISBN / authors / keywords / etc. SEARCH; CITATION SEARCH; ADVANCED SEARCH. Search in: This Publication. search. Advanced |
| 631 | 4wbs | - | http://rave.ohiolink.edu/etdc/view?acc_num=osu1523988371297363 | Genetic investigation of how an ATP hydrolysis cycle is coupled to lipopolysaccharide transport | 2018 | BW Simpson - 2018 - rave.ohiolink.edu | 36 1.3.1 Architecture of the ABC transporter family ..... 36 118 3.3.7 Crystallography data processing and structure determination ..... 118 6 Figure 1.3 MsbA undergoes structural conformational changes proposed to mediate LPS flipping This open dimer has also been observed for structures of LptB captured in the apo-state (PDB 4WBS, unpublished), |
| 632 | 3tde | 3s82, 3rv2 | http://www.freepatentsonline.com/9879043.html | Synthesis of non-natural cofactor analogs of S-adenosyl-L-methionine using methionine adenosyltransferase | 2018 | J Thorson, T Huber, J Zhang, S Singh- US Patent 9,879,043, 2018 - freepatentsonline.com | marinum ( PDB code 3RV2), Mycobacterium avium ( PDB code 3S82), Mycobacterium tuberculosis ( PDB code 3TDE ), Rattus norvegicus [36 Protein Data Bank ( PDB ) ID:1RG9), hMAT2A ( PDB ID:2PO2) and hMAT1A ( PDB ID:2OBV) on the hMAT2A homodimeric structure |
| 633 | 5umf | 3fdz | https://www.frontiersin.org/articles/10.3389/fcimb.2018.00352/full | CSGID Solves Structures and Identifies Phenotypes for Five Enzymes in Toxoplasma gondii | 2018 | E Filippova, AS Halavaty, G Minasov- Frontiers in cellular, 2018 - eprints.whiterose.ac.uk | Crystallography revealed insights into the overall structure , protein oligomeric states and molecular details of active sites important for ligand recognition The targets studied herein were crystallized and their structures characterized, as structural studies have |
| 634 | 3grk | 4j07, 3tzq, 4eit, 3s55 | http://search.proquest.com/openview/866f26bea089278c732b5974a08038aa/1?pq-origsi... | Crosslinked helix dimers as versatile scaffolds for mimicking topologically complex epitopes | 2018 | MG Wuo - 2018 - search.proquest.com | 1 1.2 Surface architecture variation among PPIs affect ligandability ..... 3 aliphatic core but lacks any heptad repeat structure and knob/hole packing orientation. ( PDB Codes: 1LLM, 1TMX, 3V3E) .... 57 |
| 635 | 5dld | 4hwg | http://www.jbc.org/content/early/2018/05/15/jbc.RA118.001971.abstract | The tetrameric structure of sialic-acid-synthesizing UDP-GlcNAc 2-epimerase from Acinetobacter baumannii: a comparative study with human GNE | 2018 | TP Ko, SJ Lai, TJ Hsieh, CS Yang, Y Chen- Journal of Biological Chemistry, 2018 - ASBMB | Crystal structures of the non-hydrolyzing enzyme are known for at least ten species [ PDB ID: 1F6D, 1O6C, 1V4V, 3BEO, 3DZC, 3OT5, 4HWG, 4NEQ, 5DLD , 5ENZ, and The UDP-interactions with NeuC are fewer than those observed in the GNE structure , probably because |
| 636 | 4ywj | 4f3y, 3ijp | https://portlandpress.com/biochemj/article-abstract/475/1/137/50160 | Plant DHDPR forms a dimer with unique secondary structure features that preclude higher-order assembly | 2018 | SAJ Watkin, JR Keown, E Richards- Biochemical, 2018 - portlandpress.com | DHDPR from a total of nine bacterial species, whereas no plant DHDPR structures were previously and X-ray crystallography to demonstrate how small elements of secondary structure are able Additionally, we use kinetic assays and an analysis of the structural flexibility of the |
| 637 | 6blj | - | https://www.mdpi.com/2073-4425/9/12/612 | Acceptor Stem Differences Contribute to Species-Specific Use of Yeast and Human tRNASer | 2018 | MD Berg, J Genereaux, Y Zhu, S Mian, GB Gloor- Genes, 2018 - mdpi.com | sapiens (4L87; [46]), Naegleria fowleri ( 6BLJ ), and Thermus thermophilus (1SET; [47]) from the Protein Data Bank were used to construct a structural alignment. ASN.1 files for each structure were obtained from the Molecular Modeling Database, and the structures were aligned |
| 638 | 3p96 | - | http://ir.inflibnet.ac.in:8080/jspui/bitstream/10603/224095/3/jbc%202014.pdf | Identification of Novel Drug Target Pathways and Scaffolds to Combat Tuberculosis | 2018 | A Garima - 2018 - ir.inflibnet.ac.in | of Porphyromonas gingivalis into host cells by modulating host cytoskeletal architecture , innate immune of SerB1- and SerB2-modeled proteins over 3FVV and 3P96 , respectively, resulted The superimpositions of SerB1 and SerB2 models over HPSP crystal structure resulted in |
| 639 | 3i4e | - | https://www.biorxiv.org/content/early/2018/05/09/318345.short | Three enzymes and one substrate; regulation of flux through the glyoxylate shunt in the opportunistic pathogen, Pseudomonas aeruginosa. | 2018 | AL Crousilles, SK Dolan, P Brear, DY Chirgadze- bioRxiv, 2018 - biorxiv.org | IDH active site architecture with that of ICD in the AceK-ICD complex from E. coli ( PDB ; 3LCB) reveals that X-ray Diffraction, Structure Determination, and Refinement ICL, IDH and ICD were solved using the structural templates 3I4E (to be published), 4ZDA (to be published) and |
| 640 | 3tmg | - | https://www.frontiersin.org/articles/10.3389/fmicb.2018.02536/abstract | The GbsR family of transcriptional regulators: functional characterization of the OpuAR repressor | 2018 | E Bremer, S Ronzheimer, B Warmbold- Frontiers in, 2018 - frontiersin.org | the linker region, an aromatic cage is predicted as the inducer-binding site, whose envisioned architecture resembles that subtilis GbsR protein (Nau-Wagner et al., 2012); it is based on the crystal structure of the DNA-binding protein Mj223 of M. jannaschii ( PDB entry 1KU9 |
| 641 | 4fry | - | http://www.jbc.org/content/early/2018/09/21/jbc.RA118.003830.short | Chromophorylation of cyanobacteriochrome Slr1393 from Synechocystis sp. PCC 6803 is regulated by protein Slr2111 through allosteric interaction | 2018 | Q He, QY Tang, YF Sun, M Zhou, W Grtner- Journal of Biological, 2018 - ASBMB | Taking the crystal structure of Bammc 406_4587 (a putative signal-transduction protein with CBS domains from Burkholderia ambifaria MC40-6, pdb code: 4fry ) (26) as template, a three-dimensional model of Slr2111 was constructed (Fig. 2 BE) |
| 642 | 3ijp | 4ywj, 4f3y | https://www.sciencedirect.com/science/article/pii/S0006291X18316516 | 4-Hydroxy-tetrahydrodipicolinate reductase from Neisseria gonorrhoeae structure and interactions with coenzymes and substrate analog | 2018 | S Pote, SE Pye, TE Sheahan- Biochemical and, 2018 - Elsevier | In case of NgDapB, the position of the coenzyme is modeled using structure of PaDapB ( PDB ID from Bartonella henselae, Burkholderia thailandensis, Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus and Thermotoga maritima ( PDB IDs: 3IJP , 4F3Y, 1ARZ, 4YWJ, 3QY9, 1VM6). |
| 643 | 5eo6 | - | https://scholarworks.montana.edu/xmlui/handle/1/14685 | A molecular, structural, and cellular multiple-level study aimed at understanding the unique reaction catalyzed by the last enzyme in the heme-biosynthesis pathway of | 2018 | AI Celis Luna - 2018 - scholarworks.montana.edu | Overlay of the structures of a representative heme b-bound chlorite dismutase and solvent This research aimed to understand ChdC function at the molecular, structural , and cellular levels The coproheme-bound ChdC structure revealed a helical-loop that is flexible and moves |
| 644 | 5bq2 | - | https://www.sciencedirect.com/science/article/pii/S2352914818301060 | Molecular modelling and dynamic simulation of UDP-N-acetylglucosamine 1-carboxyvinyltransferase (MurA) from Mycobacterium tuberculosis using in silico | 2018 | MA Isa, RS Majumdar, S Haider- Informatics in Medicine, 2018 - Elsevier | structure of UDP-N-acetylglucosamine -1-carboxyvinyltransferase (MurA) is not available in PDB . Therefore, the 3D structure was determined through the sequence, obtained from NCBI (Accession result of a BLASTp search against PBD, six proteins (3SG1, 5BQ2 , 3ISS, 1A2N |
| 645 | 3oc6 | - | http://www.mdpi.com/1422-0067/19/9/2518 | Biochemical Characterization and Structural Modeling of Fused Glucose-6-Phosphate Dehydrogenase-Phosphogluconolactonase from Giardia lamblia | 2018 | L Morales-Luna, H Serrano-Posada- International journal of, 2018 - mdpi.com | Recent Trends and Applications of Molecular Modeling in GPCRLigand Recognition and Structure -Based Drug Design. Choose your preferred view mode Giardia lamblia. G6PD. purification. recombinant expression. bioinformatics analysis. three-dimensional structure |
| 646 | 3ej2 | - | https://www.ingentaconnect.com/contentone/ben/loc/2018/00000015/00000009/art0001... | Synthesis and Activity of 1, 2, 3-Triazolyl-chalcones Against the Fungus Colletotrichum lindemuthianum | 2018 | JC Pessoa, RF Azevedo, SF Mota- Letters in Organic, 2018 - ingentaconnect.com | 3.6. Enzymes Complexed with Ligands Similar to Com- pound 1a The structure of compound 1a proteins were downloaded from the RCSB Protein Data Bank (http://www. pdb .org) [36 protein kinase (STPK; code: 2AYP) [29], inorganic phosphatase (IP; code: 3EJ2 ) [30], Bruton's |
| 647 | 4egq | - | https://www.sciencedirect.com/science/article/pii/S0167732217360439 | Identification of natural inhibitors against Acinetobacter baumanniid-alanine-d-alanine ligase enzyme: A multi-spectrum in silico approach | 2018 | S Ahmad, S Raza, SW Abbasi, SS Azam- Journal of Molecular Liquids, 2018 - Elsevier | The protein after retrieval from PDB was subjected to a preparation phase, where only one 5), with minor effect on the overall structure baumannii), (3V4Z, Yersinia pestis), (4DGJ, Burkholderia xenovorans), (4EGO, Burkholderia ambifaria), ( 4EGQ , Burkholderia pseudomallei) |
| 648 | 4dlp | 4ncx | https://www.biorxiv.org/content/early/2018/10/11/440891.abstract | Aminoacyl tRNA Synthetases as Malarial Drug Targets: A Comparative Bioinformatics Study | 2018 | DW Nyamai, OT Bishop- bioRxiv, 2018 - biorxiv.org | are highly conserved in their catalytic domains, in general aaRSs show sequence, structural 62 catalytic site architecture and the manner of charging tRNA [18,20] the connective peptide I (CPI) in all enzymes in this class whose structure is characteristic of 113 |
| 649 | 4g5d | 4gie | http://www.biochemj.org/content/475/16/2593.abstract | A role for trypanosomatid aldo-keto reductases in methylglyoxal, prostaglandin and isoprostane metabolism | 2018 | AJ Roberts, J Dunne, P Scullion, S Norval- Biochemical, 2018 - biochemj.org | Multiple sequence alignment of SakRI, TcAKR (TcCLB.511287.49), LiPGFS1 (LinJ.31.2210), LiPGFS2 (LinJ.32.0470) and TbPGFS (Tb927.11.4700). The conserved AKR catalytic tetrad identified in T. brucei is marked by the red boxes. Blue boxes indicate solvent accessible cysteine residues identified in the crystal structures of TbPGFS TcAKR and LiPGFS2 (PDB accession numbers 1VBJ, 4GIE and 4G5D) [27]. Orange box highlighting Y51C allelic variation was observed in CL-Brener. |
| 650 | 4ege | - | https://link.springer.com/article/10.1007/s12033-018-0097-0 | Trichomonas vaginalis metalloproteinase TvMP50 is a monomeric Aminopeptidase P-like enzyme | 2018 | R Arreola, JL Villalpando, J Puente-Rivera- Molecular, 2018 - Springer | Superposition with E. coli Prolidase Structure ( PDB : 4QR8) 4EGE and 4QR8 are dimers but 4EGE contains a CRE_N domain in the N-terminal determined N-terminal domain; however, as we showed in this study, this domain maintains a closely related architecture with AMP_N |
| 651 | 3qxz | - | http://www.bdjn.org/APP_PDF/BDJN006-02-04.pdf | Purification, crystallization and X-ray crystallographic analysis of enoyl-CoA hydratase/isomerase-family protein from Cupriavidus necator H16 | 2018 | H Seo, KJ Kim- Biodesign, 2018 - bdjn.org | The structure of H16_B0756 was determined by molecular replacement with the CCP4 version of MOLREP (Vagin and Teplyakov 2009) using the structure of probable enoyl-CoA hydratase/isomerase from Mycobacterium abscessus ( PDB code 3QXZ ) as a search model |
| 652 | 3pgz | 5j3b | https://repositorio.unesp.br/handle/11449/153962 | Caracterizao molecular da atividade de interao da protena RPA-1 com os telmeros de Leishmania spp. | 2018 | GAGD Santos - 2018 - repositorio.unesp.br | Recently, using molecular dynamics simulations we have shown that the tertiary structure of LaRPA-1 differs from human and yeast RPA-1 and A structural search for proteins that share with the TEP domains of protein-DNA interaction, showed that in the genome of Leishmania |
| 653 | 4ed9 | - | https://www.sciencedirect.com/science/article/pii/S1570963918301808 | Rv3272 encodes a novel Family III CoA transferase that alters the cell wall lipid profile and protects mycobacteria from acidic and oxidative stress | 2018 | KS Shrimant, S Pandey, A Ansari, S Das- et Biophysica Acta (BBA, 2018 - Elsevier | The structure was found similar to the homologues available including MCR ( PDB ID: 1X74), CaiB ( PDB ID: 1XA3), FRC ( PDB ID: 2VJQ), FRC ( PDB ID: 3UBM), ACOCT ( PDB ID: 4ED9 ), YfdE ( PDB ID: 4HL6 3.5. Solution structure using Small Angle X-ray Scattering (SAXS). |
| 654 | 3oa1 | - | https://148.204.103.62/handle/123456789/24905 | Modelado molecular de la fosfoprotena del virus de la rabia | 2018 | EM Dvila Gonzlez - 2018 - 148.204.103.62 | De los servidores de NCBI y PDB se obtuvo la secuencia consenso, as como los templetes del alineamiento del monomero del virus de la rabia (azul) con el cristal 3OA1 (amarillo AAV Albertini, GS, W Weissenborn, RWH Ruigrok, Structural Aspect of Rabies Virus Replication |
| 655 | 3meq | - | http://pubs.acs.org/doi/abs/10.1021/jacs.7b12369 | Activity-Related Microsecond Dynamics Revealed by Temperature-Jump Forster Resonance Energy Transfer Measurements on Thermophilic Alcohol | 2018 | MB Vaughn, J Zhang, TG Spiro, RB Dyer- Journal of the, 2018 - ACS Publications | protein motions. figure Figure 1. Structure of ht-ADH in green with NADH and alcohol in cyan. The three tryptophan residues are yellow. This structure was created from an overlap of PDB : 1RJW and 3MEQ . The steady state |
| 656 | 4g67 | 4f3n | https://www.sciencedirect.com/science/article/pii/S2211124718311938 | Proteobacterial Origin of Protein Arginine Methylation and Regulation of Complex I Assembly by MidA | 2018 | UFS Hameed, O Sanislav, ST Lay, SJ Annesley- Cell reports, 2018 - Elsevier | (A) Secondary structure representation of the MidA crystal structure bound to SAH (E) Superimposition of MidA (green) onto the putative protein Q6N1P6 ( PDB : 1zkd) from R. palustris (orange) and ACR COG1565 ( PDB : 4g67 ) from B. thailandensis (purple); RMSD = 1.68 |
| 657 | 4eo9 | - | https://scripts.iucr.org/cgi-bin/paper?di5015 | Ensembles generated from crystal structures of single distant homologues solve challenging molecular-replacement cases in AMPLE | 2018 | DJ Rigden, JMH Thomas, F Simkovic- Section D: Structural, 2018 - scripts.iucr.org | 1e59) was determined at a very high resolution (1.3 A ) while the other ( PDB entry 4eo9 ) was only at moderate resolution (2.45A). From this set, the structure of ecdysone phosphate phosphatase ( PDB entry 3c7t The third was a set of manually edited crystal structure derivatives |
| 658 | 3rih | 3pk0 | https://pubs.acs.org/doi/abs/10.1021/acs.biochem.8b00464 | Structure and Kinetics of the S-(+)-1-Amino-2-propanol Dehydrogenase from the RMM Microcompartment of Mycobacterium smegmatis | 2018 | E Mallette, MS Kimber- Biochemistry, 2018 - ACS Publications | We determined the structure of APDH in both apo form (at 1.7 ) and as a ternary enzyme complex with NADP + and aminoacetone... This work has shown that 3PK0 (APDHMSM0779) is an orthologue, and analysis (see below) suggests that 3RIH is also likely a Mycobacterial APDH orthologue |
| 659 | 4ffc | 3r4t | https://www.mdpi.com/1420-3049/23/5/1128/htm | Novel-Substituted Heterocyclic GABA Analogues. Enzymatic Activity against the GABA-AT Enzyme from Pseudomonas fluorescens and In Silico Molecular | 2018 | E Tovar-Gudio, JA Guevara-Salazar- Molecules, 2018 - mdpi.com | -Aminobutyric acid (GABA) is the most important inhibitory neurotransmitter in the central nervous system, and a deficiency of GABA is associated with serious neurological disorders. Due to its low lipophilicity, there has been an intensive search for new molecules with increased |
| 660 | 3r4t | 4ffc | https://www.mdpi.com/1420-3049/23/11/2984 | QSAR and Molecular Docking Studies of the Inhibitory Activity of Novel Heterocyclic GABA Analogues over GABA-AT | 2018 | J Rodrguez-Lozada, E Tovar-Gudio- Molecules, 2018 - mdpi.com | We have previously reported the synthesis, in vitro and in silico activities of new GABA analogues as inhibitors of the GABA-AT enzyme from Pseudomonas fluorescens... To incorporate the prosthetic group (PLP) in the homology models an alignment employing a crystal structure that possessed the PLP was done (3r4t and 1ohw for the Pseudomonas and human models respectively). |
| 661 | 6cau | - | http://www.bdjn.org/APP_PDF/BDJN006-03-04.pdf | Phase determination of the UDP-N-acetylmuramic acid: L-alanine ligase (MurC) crystal from Mycobacterium bovis | 2018 | PW Seo, JS Kim - 2018 - bdjn.org | Haemophilus influenzae ( PDB ID 1P31, 1GQQ), Acinetobacter baumannii ( PDB ID 6CAU ), Yersinia pestis ( PDB ID 4HV4 of the PHENIX suite (Adams et al., 2010) using Y. pestis MurC ( PDB ID 4HV4 Structure of Escherichia coli UDP-N-acetylmuramoyl: L-alanine ligase (MurC) |
| 662 | 2lxf | - | https://baylor-ir.tdl.org/handle/2104/10322 | Machine Learning-assisted Prediction of Structure and Function of Cystine-stabilized Peptides and Optimization of Expression in an E. coli System | 2018 | SMA Islam - 2018 - search.proquest.com | Each type is annotated with its name, PDB id, function and jmol estimated average 3D structural distance between disulfide bonds PBS Phosphate buffered saline PDB Protein data bank QSAR Quantitative structure activity relationship QSO Quasi-sequence-order |
| 663 | 3s6d | - | http://www.pnas.org/content/early/2018/01/25/1711837115.short | Method to generate highly stable D-amino acid analogs of bioactive helical peptides using a mirror image of the entire PDB | 2018 | M Garton, S Nim, TA Stone, KE Wang- Proceedings of the, 2018 - National Acad Sciences | Physiology; Plant Biology; Population Biology; Psychological and Cognitive Sciences; Sustainability Science; Systems Biology. Method to generate highly stable D-amino acid analogs of bioactive helical peptides using a mirror image of the entire PDB |
| 664 | 4f3p | - | https://www.sciencedirect.com/science/article/pii/S0141813018328228 | Local structural motifs in proteins: Detection and characterization of fragments inserted in helices | 2018 | N Balasco, G Smaldone, A Ruggiero- International journal of, 2018 - Elsevier | insertion: A) the substrate binding proteins ( PDB IDs: 1GGG, 1HLS, 1IIT, 2IEE, 2YLN, 4EQ9, 4F3P , 4H5F, 4I62 in red, 3QFH in blue), and C) the elongation factors EF-1A/EF-Tu ( PDB IDs: 1EFC In particular, they could (a) present an irregular loop structure , (b) form -hairpins or |
| 665 | 4qfh | - | http://repositorio.unicamp.br/handle/REPOSIP/332683 | Identificao e caracterizao de inibidores da enzima glicose-6-fosfato isomerase de Leishmania mexicana | 2018 | SGR Mota - 2018 - repositorio.unicamp.br | A computational analysis of cavities present on LmPGI crystallographic structure suggests a potential binding site for the inhibitors PBS Phosphate Buffer Solution PDB Protein Data Bank SSGCID Seattle Structural Genomics Center for Infectious Diseases |
| 666 | 2kn9 | - | https://www.frontiersin.org/articles/10.3389/fpls.2018.01333/abstract | A two-headed monster to avert disaster: HBS1/SKI7 is alternatively spliced to build eukaryotic RNA surveillance complexes | 2018 | JO Brunkard, B Baker- Frontiers in plant science, 2018 - frontiersin.org | Recently, structural studies of the cytoplasmic RNA exosome in yeast and humans have revealed the crucial importance of SKI7 in bridging ... The N-terminus of SKI7 (through the patch 4-like motif) structure was modeled by Phyre24, which used structures of YY1-associated factor 2 (PDB 2D9G), HBV-associated factor (PDB 2CRC), Rubredoxin B (PDB 2KN9), NEMO CoZi (PDB 4OWF), and TAB3-NZF (PDB 3A9K). |
| 667 | 4z9n | - | https://link.springer.com/article/10.1007/s00253-018-9073-7 | Characterization of the caprolactam degradation pathway in Pseudomonas jessenii using mass spectrometry-based proteomics | 2018 | M Otzen, C Palacio, DB Janssen- Applied microbiology and biotechnology, 2018 - Springer | 4282 5 1154 Acyl-CoA dehydrogenase 42, Thermus thermophilus 1.3.99.2 2DVL 2532 28 1031 ABC transporter, amino acid binding protein 59, Brucella ovis 4Z9N 3504 39 1922 Serine protein kinase 77, E. coli 2.7.11.1 P0ACY5 |
| 668 | 3nfw | 4l82 | https://www.sciencedirect.com/science/article/pii/S0003986118302182 | Crystal structure of the flavin reductase of Acinetobacter baumannii p-hydroxyphenylacetate 3-hydroxylase (HPAH) and identification of amino acid residues | 2018 | A Yuenyao, N Petchyam, N Kamonsutthipaijit- Archives of Biochemistry, 2018 - Elsevier | The structure was refined to 2.9 resolution with an R work and R free of 0.2534 and 0.2889, respectively somnus ( PDB ID: 2R0X, Z = 21.8 RMSD = 1.3 ), Mycobacterium thermoresistibile nitrilotriacetate monooxygenase component B (NTA-MoB) ( PDB ID: 3NFW , Z = 21.5 |
| 669 | 5vog | 4mh4 | https://www.tdx.cat/handle/10803/663022 | Phase Combination and its Application to the Solution of Macromolecular Structures: Developing ALIXE and SHREDDER | 2018 | CL Milln Nebot - 2018 - tdx.cat | Table 1 Test set for performance evaluation of SHREDDER and ALIXE... ID PDB 5VOG solvent content |
| 670 | 6bfu | - | https://www.nature.com/articles/s41598-018-34171-7 | Stabilized coronavirus spikes are resistant to conformational changes induced by receptor recognition or proteolysis | 2018 | RN Kirchdoerfer, N Wang, J Pallesen, D Wrapp- Scientific reports, 2018 - nature.com | Structural description of SARS-CoV S 2P ectodomain Structure of the SARS-CoV S 2P ectotodomain fusion peptide 24 adopts a conformation distinct from equivalent regions in (b) alpha- (HuCoV-NL63, 5SZS. pdb 20 ) and (c) deltacoronavirus spikes (PDCV S, 6BFU . pdb 21 ) as |
| 671 | 3mqw | 3m1x | https://link.springer.com/article/10.1007/s00436-018-6065-6 | Identification of a perchloric acid-soluble protein (PSP)-like ribonuclease from Trichomonas vaginalis | 2018 | A Villalobos-Osnaya, G Garza-Ramos, IN Serratos- Parasitology, 2018 - Springer | The trimeric model was built using a crystal- lographic ribonuclease structure ( PDB ID: 3R0P) as a tem resolution less than 2 (1QU9, 3M1X, 2UYK, 2UYN, 2CVL, 1JD1, 1QD9, 3QUW, 3MQW , 3VCZ, 1ONI 4e). To gain insight the secondary structure properties of rTv-PSP1, itsfar |
| 672 | 4tyz | - | https://repository.arizona.edu/handle/10150/630376 | PROTEIN-PROTEIN INTERACTIONS OF HUMAN PARVOVIRUS B19 NS1 AND IDENTIFICATION OF THE NS1 TRANSCRIPTIONAL TRANSACTIVATION DOMAIN | 2018 | AL Morano - 2018 - repository.arizona.edu | Page 1. PROTEIN-PROTEIN INTERACTIONS OF HUMAN PARVOVIRUS B19 NS1 AND IDENTIFICATION OF THE NS1 TRANSCRIPTIONAL TRANSACTIVATION DOMAIN Structure: Residues 112-214 share 32% sequence identity to x-ray crysal structure in PDB file 4TYZ chain A (a protein of unknown function). |
| 673 | 3hn6 | - | https://febs.onlinelibrary.wiley.com/doi/abs/10.1002/1873-3468.13289 | Functional and solution structure studies of amino sugar deacetylase and deaminase enzymes from Staphylococcusaureus | 2018 | JS Davies, D Coombes, CR Horne, FG Pearce- FEBS, 2018 - Wiley Online Library | burgdorferi ( PDB id: 3HN6 )). This is the first time a dimeric oligomeric state for a bacterial NagB has been reported Since there are no representative NagB dimers reported, we constructed two possible dimers of NagB from the E. coli hexamer ( PDB id oligomeric structure |
| 674 | 3kw3 | - | https://www.biorxiv.org/content/early/2018/06/13/346130.abstract | Computational evidence of a new allosteric communication pathway between active sites and putative regulatory sites in the alanine racemase of Mycobacterium | 2018 | J Jyothikumar, S Chandani, R Tangirala- bioRxiv, 2018 - biorxiv.org | Fig 3 Structure -based multiple sequence alignment of alanine racemases E. coli ( PDB code: 2RJG), S. pneumoniae ( PDB code: 3S46), P. fluorescens ( PDB code: 2ODO), P. aeruginosa ( PDB code: 1RCQ), A. baumannii ( PDB code: 4QHR), B. henselae ( PDB code: 3KW3 ) |
| 675 | 3tf6 | - | http://itempdf74155353254prod.s3.amazonaws.com/6159143/DLSCORE__A_Deep_Learning_... | DLSCORE: A Deep Learning Model for Predicting Protein-Ligand Binding Affinities | 2018 | M Hassan, DC Mogollon, O Fuentes, S Sirimulla - 2018 - .s3.amazonaws.com | In designing DLSCORE architecture , we divided the entire method into two parts 2 PDB IDs 4rqv, 4tkb, 1met, 5c5t, 3p8p, 2iuz, 4kfq, 3ifl, 4p6c, 1oyt, 4ibg, 3uri, 3t01, 1o5e, 3qgy, 3kgu, 2h21, 3agl, 3n7a, 1qkt, 1o2j, 1azm, 1afk, 1g54, 3nu3, 2yhw, 4mme, 2f94, 3vha, 3tf6 , 2pvj, 1fkb |
| 676 | 4gnv | - | http://www.jbc.org/content/early/2018/01/09/jbc.RA117.000948.short | Structural and mechanistic analysis of a -glycoside phosphorylase identified by screening a metagenomic library | 2018 | SS Macdonald, A Patel, VLC Larmour- Journal of Biological, 2018 - ASBMB | in BglP it is a glutamine, as seen in the structural overlay of Figure 8C wherein the 2FGlc- BglP structure is superimposed on the structures of two other GH3 -N-acetylglucosaminidases (NagZ from Burkholderia cenocepacia in complex with GlcNAc [ PDB : 4GNV ] and NagZ from |
| 677 | 3lgj | 3pgz | https://patents.google.com/patent/US20180179500A1/en | Modified enzymes | 2018 | AJ Heron, RV Bowen, M Bruce- US Patent App. 15, 2018 - Google Patents | In order to assess whether a suitable protein structure exists to use as a template to build a protein model, a search is performed on the protein data bank ( PDB ) database The sequence alignment and template structure are then used to produce a structural model of the The polynucleotide binding motif may be selected from any of those shown in Table 5 below. Bartonella 3LGJ, Q6G302 homo-tetramer |
| 678 | 4f82 | - | https://scripts.iucr.org/cgi-bin/paper?lz5017 | Crystal structure of peroxiredoxin 3 from Vibrio vulnificus and its implications for scavenging peroxides and nitric oxide | 2018 | J Ahn, KK Jang, I Jo, H Nurhasni, GJ Lim, JW Yoo- IUCrJ, 2018 - scripts.iucr.org | The structure of reduced Prx3 (C48D/C73S) was determined using the molecular-replacement method with MOLREP in the CCP4 package (Winn et al., 2011) using a putative thioredoxin reductase from Burkholderia ceno- cepacia ( PDB entry 4f82 ; Seattle Structural |
| 679 | 3gwc | 4f4a, 4fkx, 4emd | http://14.139.186.108/jspui/handle/123456789/31568 | PROTEIN-LIGAND INTERACTIONS AND STRUCTURE-BASED INHIBITOR DISCOVERY | 2018 | S Usha, S Selvaraj - 2018 - 14.139.186.108 | i) Target structure A target structure experimentally determined through X-ray crystallography or NMR spectroscopy techniques and deposited in the PDB is the ideal starting point for docking. Structural genomics has accelerated the rate at which target structures are |
| 680 | 3kc6 | 3khw | https://link.springer.com/chapter/10.1007/978-981-10-8456-0_5 | Structure and Function of Influenza Virus Ribonucleoprotein | 2018 | CY Lo, YS Tang, PC Shaw- Virus Protein and Nucleoprotein Complexes, 2018 - Springer | These structures include PDB : 2VY7, 2VY8, 3KC6 , 3KHW, 2GMO (solution structure of NLS-domain). Structures composing of both domains are also available ( PDB : 2VY6, 3CW4) (Tarendeau et al. 2007; Tarendeau et al. 2008; Kuzuhara et al. 2009; Yamada et al |
| 681 | 4ggq | - | https://www.sciencedirect.com/science/article/pii/S0959440X18300976 | Enzyme targets for drug design of new anti-virulence therapeutics | 2018 | CM Kahler, M Sarkar-Tyson, EA Kibble- opinion in structural, 2018 - Elsevier | Mip from Burkholderia pseudomallei as a complex with a pipecolic acid derivative (CJ40) ( PDB : 4GGQ ) d) Ribbon diagram of the structure of EptA ( PDB : 5FGN a detailed understanding of the mechanism of substrate binding and catalysis will enable a structure guided approach |
| 682 | 3o0h | - | http://eprints.sunway.edu.my/893/ | Sulphur (lone pair) interactions with FAD in flavoenzymes | 2018 | RFN Silva, ACS Sacco, I Caracelli- Zeitschrift fur, 2018 - eprints.sunway.edu.my | Finally, in the 22 SOX enzymes found in PDB , there were 45 monomers having FAD S(lp)(FAD) interactions in three examples of GR enzymes: (a) 1K4Q [64], (b) 3O0H [64] and with FAD via S(lp)(FAD) interactions that pro- vide stability to the secondary structure and |
| 683 | 4zju | 4zr8, 5ha4 | https://www.tandfonline.com/doi/abs/10.1080/07391102.2018.1451387 | Screening of Potential Lead Molecules Against Prioritized Targets of Multi-Drug Resistant Acinetobacter Baumannii- Insights From Molecular Docking, Molecular Dynamic | 2018 | S Skariyachan, M Manjunath- Biomolecular Structure, 2018 - Taylor & Francis | Fourteen potential drug targets were screened based on their functional role in various biosynthetic pathways and the 3D structures of 9 The study suggests that the aforementioned lead candidates and targets can be used for structure -based drug screening towards MDR A |
| 684 | 3dmp | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/cctc.201701223 | Enzymatic Production of NonNatural Nucleoside5Monophosphates by a Thermostable Uracil Phosphoribosyltransferase | 2018 | J del Arco, J Acosta, HM Pereira, A Perona- , 2018 - Wiley Online Library | Overall structure and architecture of active site. We have determined the crystal structure of TtUPRT ( PDB 1v9s) at 2.1 resolution (Table 1). The 1o5), UPRT from Escherichia coli (EcUPRT; PDB 2ehj), UPRT from Burkholderia pseudomallei (BpUPRT; PDB 3dmp ), UPRT from |
| 685 | 4h4g | - | https://www.sciencedirect.com/science/article/pii/S1096717617303658 | Combination of type II fatty acid biosynthesis enzymes and thiolases supports a functional -oxidation reversal | 2018 | JM Clomburg, SC Contreras, A Chou, JB Siegel- Metabolic, 2018 - Elsevier | The PDB codes for the 10 matches with the lowest E-values are 4H4G , 1U1Z, 4I83, 2OKH, 1ZHG, 3D6X, 2GLL, 3B7J, 1Z6B, and For ACP, the structure coordinated from an established structure of ACP bound to the homologous protein FabA was used ( PDB code: 4KEH) |
| 686 | 4gnv | - | https://pubs.rsc.org/en/content/articlehtml/2018/cc/c8cc05281f | A mechanism-based GlcNAc-inspired cyclophellitol inactivator of the peptidoglycan recycling enzyme NagZ reverses resistance to -lactams in Pseudomonas | 2018 | LA Ho, JL Winogrodzki, AW Debowski- Chemical, 2018 - pubs.rsc.org | Fig. 2 Crystal structure of BcNagZ bound to 2. (A) Electron density (sigma-A weighted difference map (mF o DF c ) contoured at 4) for 2 (green carbon atoms (B) BcNagZ active site bound to 2 (green carbon atoms) with the BcNagZ product complex PDB 4GNV superposed |
| 687 | 3r4t | - | http://search.proquest.com/openview/efe1b9c57e1812b2a0458378ec81b092/1?pq-origsi... | Modeling and Docking Study of GABA-AT Protein in Mycobacterium Tuberculosis-A Computational Approach | 2018 | R Sriroopreddy, P Raghuraman- Research Journal of, 2018 - search.proquest.com | The best similarity match with the template identity of 83% ( PDB ID: 3R4T ) The secondary structure prediction was done using YASPIN server (http://zeus.few.vu.nl/).8 The result of the secondary structure prediction provides a brief idea about the folding pattern of the |
| 688 | 5vmt | 3hja | https://www.sciencedirect.com/science/article/pii/S0882401018316140 | Crystal structure of GAPDH of Streptococcus agalactiae and characterization of its interaction with extracellular matrix molecules | 2018 | R Nagarajan, S Sankar, K Ponnuraj- Microbial pathogenesis, 2018 - Elsevier | S1). The protein BLAST against Protein Data Bank ( PDB ) led to 97 hits with recently determined 71% and 69% sequence identity with S. pneumoniae (5M6D), Nessiera gonorrhea ( 5VMT ) and S to mixed-holo structure (highest resolution of 1.36 ), the present structure (Apo, 2.6 |
| 689 | 4i1i | 4h7p | https://www.arca.fiocruz.br/handle/icict/34553 | Anlise de aspectos estruturais em imunoinformtica utilizando candidatos vacinais contra Leishmaniose que foram selecionados usando vacinologia reversa. | 2018 | JPL Velloso - 2018 - arca.fiocruz.br | Considering the importance of protein structure in immunological interactions and in vaccine infantum, protein modeling, molecular docking, structural protein disorder. Page 11. LISTA DE QUADROS NCBI - National Center for Biotechnology Information PDB - Protein Data Bank |
| 690 | 4f3y | 4eqy, 5bq2, 5uy7 | https://www.sciencedirect.com/science/article/pii/S0882401018312464 | Reverse vaccinology and subtractive genomics-based putative vaccine targets identification for Burkholderia pseudomallei Bp1651 | 2018 | Z Nazir, SG Afridi, M Shah, S Shams, A Khan- Microbial pathogenesis, 2018 - Elsevier | 2.9. Protein 3D structures prediction. The target proteins structural information is vital for predicting immunogenic domains. The structure information of the target proteins was assessed by BLASTp analysis against Protein Data Bank ( PDB ) [42,43]. 2.10. Antigenicity prediction |
| 691 | 4kyx | - | https://www.nature.com/articles/s41477-018-0220-z | Contribution of isopentenyl phosphate to plant terpenoid metabolism | 2018 | LK Henry, ST Thomas, JR Widhalm, JH Lynch- Nature plants, 2018 - nature.com | To precisely define the structural basis for substrate selectivities of AtNudx1, we next obtained diffraction-quality crystals for atomic superposition of the previously reported catalytically impaired AtNudx1 mutant, E56A, with GPP bound ( pdb 5GP0) and our structure with IPP |
| 692 | 4p8r | 4lsm | https://www.sciencedirect.com/science/article/pii/S1570963918300220 | Structural studies of glyceraldehyde-3-phosphate dehydrogenase from Naegleria gruberi, the first one from phylum Percolozoa | 2018 | ATP Machado, M Silva, J Iulek- et Biophysica Acta (BBA)-Proteins and, 2018 - Elsevier | cruzi (glicosomal) ( PDB : 4LSM) [12], Trypanosoma brucei (glicosomal) ( PDB : 4P8R ) [13], Leishmania 3PYM), Homarus americanus ( PDB : 1GPD) [46] and Escherichia coli ( PDB : 1GAD) [47 general, they are similar, with some differences in secondary structure elements; RMSD |
| 693 | 6ao8 | - | https://www.sciencedirect.com/science/article/pii/S0022283618302456 | Structure of Escherichia coli Arginyl-tRNA Synthetase in Complex with tRNAArg: Pivotal Role of the D-loop | 2018 | P Stephen, S Ye, M Zhou, J Song, R Zhang- Journal of molecular, 2018 - Elsevier | 14]), Campylobacter jejuni (3FNR, unpublished), Plasmodium falciparum (5JLD[15]), Neisseria gonorrhoeae ( 6AO8 , unpublished), Escherichia crystal structure of EcoArgRS in complex with tRNA Arg (deposited under PDB code: 5YYN) representing the first structure of a |
| 694 | 4z9n | - | http://rnajournal.cshlp.org/content/24/11/1530.short | Signal transduction-dependent small regulatory RNA is involved in glutamate metabolism of the human pathogen Bordetella pertussis | 2018 | K Keidel, F Amman, I Bibova, J Drzmisek, V Benes- RNA, 2018 - rnajournal.cshlp.org | Besides its role in the stabilization of the RNA duplexes, Hfq can also actively remodel the structure of RNAs and increase or decrease the stability of BLAST search unveiled that the BP3831 protein exhibits high homology with the entry 4Z9N in the PDB protein database |
| 695 | 4j07 | - | https://www.sciencedirect.com/science/article/pii/S002235491830306X | Biomedical Applications of Lumazine Synthase | 2018 | Y Wei, P Kumar, N Wahome, NJ Mantis- Journal of, 2018 - Elsevier | Oligomeric State of LS, Quaternary Structure , Organism, PDB ID 16, 17, 18 Mycobacterium leprae 19 S. cerevisiae 20 Schizosaccharomyces pombe 21, 1DI0 2F59; 2I0F 2OBX 2O6H 2JFB 1C41 2VI5; 2C9B; 2C92; 2C94; 2C97; 2C9D; 1W19; 1W29 4J07 1EJB 1KYV |
| 696 | 3rih | 3uve | https://cyberleninka.ru/article/n/rol-zaryazhennyh-ostatkov-v-strukturnoy-adapta... | The Role of Charged Residues in the Structural Adaptation of Short-Chain Alcohol Dehydrogenase (SDR) from Thermophilic Organisms to High Temperatures | 2018 | Bulletin of Moscow University. Series 2. Chemistry, 2018 - cyberleninka.ru | PDB (*), 3RIH (Mycobacterium Abscessus*) 2,36 2,36 1,32 7,62 8 THE ROLE OF CHARGED RESIDUES IN THE STRUCTURAL ADAPTATION OF SHORT-CHAIN |
| 697 | 5kha | 4f4h | http://www.jbc.org/content/early/2018/03/26/jbc.RA118.002241.short | Kinetics and structural features of dimeric Gln-dependent bacterial NAD+ synthetases suggest evolutionary adaptation to available metabolites | 2018 | ARS Santos, ECM Gerhardt, VR Moure- Journal of Biological, 2018 - ASBMB | -Proteobacterium Burkholderia thailandensis ( PDB 4F4H) and from the -Proteobacterium Acinetobacter baumannii ( PDB 5KHA ) of dimeric NadE2Gln Given the availability of a 1.7 resolution structure of dimeric NadE2Gln from B. thailandensis ( PDB 4F4H) obtained |
| 698 | 5thw | 4wjb, 5i4m | https://www.nature.com/articles/s41598-018-31259-y | A fundamental catalytic difference between zinc and manganese dependent enzymes revealed in a bacterial isatin hydrolase | 2018 | T Sommer, K Bjerregaard-Andersen, L Uribe- Scientific reports, 2018 - nature.com | with a central scaffold resembling the swivelling // fold 18 , while the majority of AHS members contains a monomeric (/) 8 -TIM like-barrel structural fold 19 The finalised model and structure factors were deposited to Protein Data Bank ( PDB ) and given the PDB |
| 699 | 4j07 | - | https://kuscholarworks.ku.edu/handle/1808/27856 | Strategies to improve the immunogenicity of subunit vaccine candidates | 2018 | Y Wei - 2018 - kuscholarworks.ku.edu | Oligomeric state of lumazine synthase Quaternary structure Organism PDB ID Pentamer 1DI0 2F59 ; 2I0F 2OBX 2O6H 2JFB 1C41 2VI5; 2C9B; 2C92; 2C94; 2C97; 2C9D; 1W19; 1W29 4J07 1EJB 1KYV; 1KYX; 1KYY Decamer Brucella spp |
| 700 | 5if3 | - | https://www.sciencedirect.com/science/article/pii/S1369703X18301530 | Semi-rational engineering of carbonyl reductase YueD for efficient biosynthesis of halogenated alcohols with in situ cofactor regeneration | 2018 | M Naeem, AU Rehman, B Shen, L Ye, H Yu- Biochemical Engineering, 2018 - Elsevier | Modeller 9.12 package on the basis of the crystal structure of a short-chain dehydrogenase/ reductase SDR ( PDB ID: 5if3 ) from Burkholderia amino acid residues for site directed mutagenesis, docking of the model substrate 3-bromoacetophenone into the structure of YueD |
| 701 | 4k9d | - | https://www.sciencedirect.com/science/article/pii/S0141113618301211 | The glyceraldehyde-3-phosphate dehydrogenase of the shrimp Litopenaeus vannamei: Molecular cloning, characterization and expression during hypoxia | 2018 | L Camacho-Jimnez, AB Peregrino-Uriarte- Marine Environmental, 2018 - Elsevier | We also made a structural analysis in silico of the deduced protein from a comparative the GAPDH holoenzyme from P. versicolor solved by X-ray diffraction (2 ) ( PDB : 1SZJ, chain Finally, the LvGAPDH multimeric complex model was obtained from the former structure with the |
| 702 | 4jcp | - | https://www.nature.com/articles/s41598-018-23821-5 | Structural basis of interaction between dimeric cyclophilin 1 and Myb1 transcription factor in Trichomonas vaginalis | 2018 | T Martin, YC Lou, CC Chou, SY Wei, S Sadotra- Scientific reports, 2018 - nature.com | S1). Like Caenorhabditis elegans Cyp3 (Ccyp3; PDB : 1DYW) and Brugia malayi CypB (BcypB; PDB : 4JCP ), TvCyP1 is a divergent loop cyclophilin and possesses an additional loop in the a) Structure of TvCyP1 dimer showing secondary structural elements ( PDB : 5YB9 |
| 703 | 5ifz | - | https://academic.oup.com/nar/advance-article-abstract/doi/10.1093/nar/gky1114/51... | SIFTS: updated Structure Integration with Function, Taxonomy and Sequences resource allows 40-fold increase in coverage of structure-based annotations for | 2018 | JM Dana, A Gutmanas, N Tyagi, G Qi- Nucleic acids, 2018 - academic.oup.com | 5.3.1.34 D-erythrulose 4-phosphate isomerase Q9ZB26 99% 5ifz 5.3.1.6 Ribose-5 of the protein sequence space 40-fold, expanding the applicability of structure -based an positions from Ensembl enables a more direct cross-referencing of genomic data from PDB structures |
| 704 | 3r4t | 4ffc | https://www.mdpi.com/1420-3049/23/5/1128 | Novel-Substituted Heterocyclic GABA Analogues. Enzymatic Activity against the GABA-AT Enzyme from Pseudomonas fluorescens and in Silico Molecular Modeling | 2018 | E Tovar-Gudio, J Guevara-Salazar, J Bahena-Herrera- Molecules, 2018 - mdpi.com | molecular docking studies to explain their inhibitory character based in different structural and electronic to the concept of molecular similarity, which states that molecules with similar structure will have Figure 6 shows the cavity of the GABA-AT ( PDB : 1SF2 from Escherichia coli |
| 705 | 3qxz | 3i3f, 3s6o | https://scholarworks.iupui.edu/handle/1805/17959 | Analysis of Pseudo-Symmetry in Protein Homo-Oligomers | 2018 | CJR Rajendran - 2018 - scholarworks.iupui.edu | Figure 3.2: PDB File format In a PDB file, as mentioned in the above figure 3.2, the Atom type is used to capture the structures are calculated to get the overall structural index Structure Index for Trimers can be calculated by measuring the distance between the original |
| 706 | 3v2i | 4dz4, 4f3y | http://scjournal.ius.edu.ba/index.php/scjournal/article/view/152 | A Computational Biology Approach in Function Annotation to Enzymes | 2018 | M Ljubijankic- Southeast Europe Journal of Soft Computing, 2018 - scjournal.ius.edu.ba | 3.5.3.1 2Q47 3.1.1.3 3.1.3.48 3SF8 3.1.6. 3.4.-.- 3V2I 3.4.19.12 3.1.1.29 is observed in the example of the survival protein E (SurE) from Thermotogamaritima ( PDB ID 1ilv). Zhang and colleagues (2001) determined the crystal structure of this protein and in their work, described it |
| 707 | 4efz | - | http://search.proquest.com/openview/3f7a517c191fc1517c1ea86b15e8f1b6/1?pq-origsi... | Structural and Mechanistic Characterization of Enzymes in Persulfide Oxidation and Monolignol Biosynthesis Pathways | 2018 | SA Sattler - 2018 - search.proquest.com | of apo-form PpPDO2 diffraction data were conducted by molecular replacement with the PDB coordinates of model 4EFZ using PHENIX Phaser (18) by molecular replacement as well, using the atomic coordinates of the unpublished structure for a |
| 708 | 3sbx | 3qua | https://onlinelibrary.wiley.com/doi/abs/10.1111/1462-2920.14287 | Structural insight into molecular mechanism of cytokinin activating protein from Pseudomonas aeruginosa PAO1 | 2018 | H Seo, KJ Kim- Environmental microbiology, 2018 - Wiley Online Library | 29.9), Mycobacterium marinum (MmLOG, PDB code 3SBX , Z-score 28.7), Mycobacterium PDB code 5AJU, Z-score 27.2), with amino acid identities higher than 40%. In contrast, the structure of PA4923 shows relatively low homology to type-II LOGs, such as those from |
| 709 | 3gaf | - | https://baadalsg.inflibnet.ac.in/jspui/bitstream/10603/196179/12/12_chapter%204.... | Sequence and structural studies of proteins associated with cell wall biosynthesis lipolysis and isoniazid drug resistance in Mycobacterium tuberculosis | 2018 | S Anishetty - 2018 - baadalsg.inflibnet.ac.in | Page 4. 63 of recognizing the native structure out of decoy structures 3D coordinates of Isoniazid-NAD adduct ( PDB : 2IDZ) and Triclosan ( PDB : 3OID) was obtained from PDB Rv0547c Oxidoreductase 5e-35 20% FX6-K - Rv0927c Oxidoreductase 1e-32 23% FX6-K 3GAF 41.32 |
| 710 | 3qk8 | 3q1t | https://repository.library.northeastern.edu/files/neu:m044c4387/fulltext.pdf | Functional Characterization of Structural Genomics Proteins through Computed Chemical Properties, Graph Representation of Active Sites, and Biochemical | 2018 | CL Mills - 2018 - search.proquest.com | These five proteins were purified separately using the same protocol: two putative enoylCoA hydratases from Streptomyces avermitilis (PDB 3GKB, gene echA1; PDB 3H0U, gene echA2), putative 3-hydroxybutyryl-CoA dehydratase from Rhodopseudomonas palustris (PDB 3HIN, gene RPA1786), putative enoyl-CoA hydratase from Mycobacterium avium (PDB 3Q1T, gene MAV_3574), and putative enoyl-CoA hydratase from Mycobacterium marinum (PDB 3QK8, gene echA15). |
| 711 | 3v9o | 3urr | https://www.biorxiv.org/content/early/2018/09/06/409730.abstract | Flexible backbone assembly and refinement of symmetrical homomeric complexes | 2018 | SSR Burman, RA Yovanno, JJ Gray- bioRxiv, 2018 - biorxiv.org | For local docking, specific symmetry definitions can be recapitulated from a PDB file of a complex About 22% of all structures are unfavorable, and all but one near-native (less than 5 number of inter-chain atom-atom clashes is 50.6, compared to 21 in the native structure |
| 712 | 5kak | - | https://books.google.com/books?hl=en&lr=&id=x6RMDwAAQBAJ&oi=fnd&pg=PR8&dq=%225KA... | Protein-protein and domain-domain interactions | 2018 | P Kangueane, C Nilofer - 2018 - books.google.com | 1.10) structures It is important to under- stand the physical and chemical features of amino acids to understand protein folding, structure , function, and 1.4 A covalent bond is illustrated using cysteine with corresponding bond length 1.5 Structural Motifs Proteins are made of |
| 713 | 3meq | - | https://pubs.acs.org/doi/abs/10.1021/jacs.7b12369 | Activity-related microsecond dynamics revealed by temperature-jump Forster resonance energy transfer measurements on thermophilic alcohol dehydrogenase | 2018 | MB Vaughn, J Zhang, TG Spiro, RB Dyer- Journal of the, 2018 - ACS Publications | Previous studies of a thermophilic alcohol dehydrogenase (ht-ADH) demonstrated a range of discontinuous transitions at 30 C that include catalysis, kinetic isotope effects, protein hydrogendeuter... Figure 1. Structure of ht-ADH in green with NADH and alcohol in cyan. The three tryptophan residues are yellow. This structure was created from an overlap of PDB: 1RJW and 3MEQ |
| 714 | 3hzg | - | https://tel.archives-ouvertes.fr/tel-02165924/ | Synthse d'analogues nuclotidiques visant l'inhibition de la Thymidylate Synthase Flavine-Dpendante | 2018 | F Chevrier - 2018 - tel.archives-ouvertes.fr | PCF2 : gem-Difluoromthylphosphonate PDB : Protein data bank pH : Potentiel hydrogne 18 Page 20. 19 I. Les bactries : structures et mcanismes d'infection Schma 1 : Structure gnrale d'une bactrie. Cependant, elles possdent des attributs essentiels leur survie |
| 715 | 5ts2 | - | http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.7b09543 | Umbrella Sampling and X-ray Crystallographic Analysis Unveil an Arg-Asp Gate Facilitating Inhibitor Binding Inside Phosphopantetheine Adenylyltransferase | 2018 | A Mondal, R Chatterjee, S Datta- The Journal of Physical, 2018 - ACS Publications | In this study, we have attempted to further comprehend the structural details and mechanisms involved in AcCoA binding Material and method: MD simulations The PPATWT-AcCoA structure used for this study was obtained from RCSB- PDB ( PDB ID: 3X1J) |
| 716 | 4k73 | - | https://repositorio.unesp.br/handle/11449/157354 | L, D-transpeptidases de Mycobacterium tuberculosis: estudo das interaes com antibiticos -lactmicos e triagem de fragmentos | 2018 | GA Libreros-Ziga - 2018 - repositorio.unesp.br | structure of LdtMt3 and its interactions with -lactam antibiotics, as well as the PDB Banco de dados de protenas (Protein Data Bank) Structural basis for the interaction and processing of -lactam antibiotics by L,D- transpeptidase 3 (LdtMt3) from Mycobacterium tuberculosis |
| 717 | 3l56 | - | http://uhra.herts.ac.uk/handle/2299/19623 | Evolutionary targeted discovery of influenza A virus replication inhibitors | 2018 | H Patel - 2018 - uhra.herts.ac.uk | 4.4.2 Structure and predicted binding site locations of the NEP NCI National cancer institute NEP Nuclear export protein NLS Nuclear localisation signal NS1 Non- structural protein 1 basic protein 1 PB2 Polymerase basic protein 2 PBS Phosphate buffer saline PDB Protein data |
| 718 | 4kyx | - | http://www.cell.com/molecular-plant/abstract/S1674-2052(17)30305-2 | Structural Insights into the Substrate Recognition Mechanism of Arabidopsis GPP-Bound NUDX1 for Noncanonical Monoterpene Biosynthesis | 2018 | J Liu, Z Guan, H Liu, L Qi, D Zhang, T Zou, P Yin- Molecular plant, 2018 - cell.com | the structure by molecular replacement based on the available coordinates (MutT, PDB : 53 4KYX ) and refined the structure at a resolution of 1.39 (Supplemental Table 1). Most of 54 such as FPP. Furthermore, our findings provide new opportunities for structure -guided 156 |
| 719 | 5upg | - | https://search.proquest.com/openview/c24741440c634a954b90086003c736d2/1?pq-origs... | Widening the Therapeutic Window: Time-Dependent Inhibitors of LpxC and InhA for Treating Multidrug-Resistant Bacterial Infections | 2018 | C Gu - 2018 - search.proquest.com | 46 Figure 2.10. X-ray crystal structure of paLpxC in complex with PF5081090 ( 5UPG . pdb ). ... 48 PD Pharmacodynamics PDB Protein Data Bank PIPES Piperazine-N,N-bis(2-ethanesulfonic acid) Sfp Phosphopantetheinyl transferase SKR Structure -kinetic relationship |
| 720 | 5idv | - | https://scripts.iucr.org/cgi-bin/paper?mf5027 | Photocage-initiated time-resolved solution X-ray scattering investigation of protein dimerization | 2018 | I Josts, S Niebling, Y Gao, M Levantino, H Tidow- IUCrJ, 2018 - scripts.iucr.org | A total of 30 independent DAMMIF (Franke & Svergun, 2009) runs were performed to generate the initial structure pool (fit not shown). Calculated difference curves between the crystallographic dimer and monomer ( PDB codes 3b60 and 5idv ) show features similar to |
| 721 | 4ot8 | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5958214/ | Chloroplastic serine hydroxymethyltransferase from Medicago truncatula: a structural characterization | 2018 | M Ruszkowski, B Sekula, A Ruszkowska- Frontiers in plant, 2018 - ncbi.nlm.nih.gov | It is very intriguing to see that, to our best knowledge, the conformation of the γ-hydroxyl group of PLP-Ser external aldimine is unique in comparison with nearly all other SHMT complexes in the PDB (PDB IDs: 1kkp, 1yjy, 2via, 2vmp, 2vmt, 2vmw, 2w7f, 2w7k, 4ot8), except for the alternative conformation (30% occupancy) in the E53Q mutant of Geobacillus |
| 722 | 3s6l | 3o2e, 3oib, 3men, 3k9g, 3km3, 3p96, 3njb | https://scripts.iucr.org/cgi-bin/paper?ba5274 | Substructure determination using phase-retrieval techniques | 2018 | P Skubk- Acta Crystallographica Section D: Structural Biology, 2018 - scripts.iucr.org | determination by PRASA has been integrated into the CRANK2 pipeline for automated structure solution from 3fki, 3gyv, 3k9g, 3km3, 3lmt, 3lmu, 3men, 3njb, 3o2e, 3oib, 3p96, 3s6l , 4us7, 4xvz the authors who kindly provided SAD data sets or deposited Bijvoet pairs in the PDB |
| 723 | 4nbr | - | https://onlinelibrary.wiley.com/doi/abs/10.1107/S2059798318005612 | MRREX: molecular replacement by cooperative conformational search and occupancy optimization on lowaccuracy protein models | 2018 | JJ Virtanen, Y Zhang- Acta Crystallographica Section D, 2018 - Wiley Online Library | et al., 2016, 2017; Shrestha & Zhang, 2015), MR-REX takes advan- tage of this fact by predicting possible inaccurate segments of the structural model and Input and output data The input to MR-REX is a set consisting of structure -factor data, a structure file in PDB format and |
| 724 | 3slg | 3swo, 3tk8, 4dz4, 5dle, 4lgo, 3t3w, 5bq2, 4lgv, 3l0g, 5kak, 4ghk, 3ld9, 5w15, 4q1t, 5udf, 4pca, 3hm0, 3inn, 3dah, 3i3f | https://link.springer.com/content/pdf/10.1007/978-981-10-7347-2.pdf#page=84 | 5.1 Creation of Homo Multimer Protein Complex Dataset | 2018 | P Kangueane, C Nilofer- Protein-Protein and Domain-Domain Interactions - Springer | 3LYU, 3M1R, 3MBH, 3MQ1, 3MW9, 3N2N, 3NWY, 3OVG, 3OZB, 3PW3, 3SBA, 3SLG , 3T3W, 3T94 Distribution of homo multimer protein complex structures at the protein data bank ( PDB ) 5.3 Structure of a homo trimer glycosidase (1AM7) from enterobacteria phage lambda is |
| 725 | 4dz4 | 5dle, 4q1t, 4pca, 5bq2, 4lgv, 5kak, 4ghk, 5udf, 4lgo, 3i3f, 3slg, 3swo, 3tk8, 3l0g, 3ld9, 3hm0, 3inn, 3t3w, 5w15, 3dah | https://link.springer.com/chapter/10.1007/978-981-10-7347-2_5 | Homo Multimer Protein Complexes | 2018 | P Kangueane, C Nilofer- Protein-Protein and Domain-Domain Interactions, 2018 - Springer | 3T3W, 3T94, 3VZD, 3WCM, 3WSG, 3WU4, 4BLP, 4BLQ, 4C01, 4C9S, 4D2E, 4DZ4 , 4FLN, 4FZQ Distribution of homo multimer protein complex structures at the protein data bank ( PDB ) Structure of a homo trimer glycosidase (1AM7) from enterobacteria phage lambda is shown |
| 726 | 5bnt | - | https://onlinelibrary.wiley.com/doi/abs/10.1107/S2053230X17017241 | Structure of aspartate semialdehyde dehydrogenase from Francisella tularensis | 2018 | NJ Mank, S Pote, KA Majorek- Section F: Structural, 2018 - Wiley Online Library | NADP+ (yellow spheres) is modeled using the structure of H. influenzae ASADH ( PDB PDB entry 3pzr; Pavlovsky et al., 2012), Pseudomonas aeruginosa ( PDB entry 5bnt ; Seattle Structural entry 1t4b; Nichols et al., 2004) and Haemophilus influenzae (HiASADH; PDB entry 1pqu |
| 727 | 4q15 | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/prot.25441 | Development of METALACTIVE SITE and ZINCCLUSTER tool to predict active site pockets | 2018 | M Ajitha, K Sundar, S Arul Mugilan- Proteins: Structure, 2018 - Wiley Online Library | As zinc ion acts as a cofactor for this protein, ZN and PDB ID (3CAJ) of this of Sobolev et al.,[14] who identified the presence of Zinc using three-dimensional structure and he 1Q15, 0.86, 2Q15, 0.86, 3Q15, 0.84, 4Q15 , 0.28, 5Q15, 0.86, 6Q15, 0.86, 7Q15, 8.86, 8Q15, 0.86, 9Q15 |
| 728 | 4wi1 | - | https://www.sciencedirect.com/science/article/pii/S135964461730538X | Drug targeting of one or more aminoacyl-tRNA synthetase in the malarial parasite Plasmodium falciparum | 2018 | M Yogavel, R Chaturvedi, P Babbar, N Malhotra- Drug discovery today, 2018 - Elsevier | HF, yellow PDB ID: 4YDQ), glyburide (violet, PDB ID: 5IFU), TCMDC-124506 (orange, PDB ID: 4WI1 ) and modeled Takeda compound B (green, PDB ID: 5VAD Among these, benzoxaboroles target the editing site of Pf-LRS cyto effectively and the crystal structure for the |
| 729 | 5udf | - | https://www.sciencedirect.com/science/article/pii/S0959440X17301586 | Translocation of lipoproteins to the surface of gram negative bacteria | 2018 | Y Hooda, TF Moraes- Current opinion in structural biology, 2018 - Elsevier | The model of LolCDE was obtained from the structure of LptBFG ( PDB ID: 5UDF )and is The structure of type IVa pilus machinery from Myxococcus xanthus ( PDB ID: 3JC9) was used as In |