SSGCID
Seattle Structural Genomics Center for Infectious Disease

Cited Structures: list of articles citing SSGCID structures

We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.

This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.

Cited structures

Manually reviewed citations

# PDB Additional SSGCID structures cited Link Title Year Citation Highlighted abstract
1 3hhj - http://www.jbc.org/content/285/1/444.short Structural and dynamic features of the MutT protein in the recognition of nucleotides with the mutagenic 8-oxoguanine base 2010 T Nakamura, S Meshitsuka, S Kitagawa, N Abe? - Journal of Biological Chemistry, 2010 - ASBMB ... ?, Z = 19.0) and with dGTP (BdRppH-dGTP, 3EF5, rmsd = 1.9 ?, Z = 18.3) (40) and unknown proteins from Bartonella henselae (3HHJ, rmsd = 1.8 ... ray and NMR structures in the ligand-free form and 3.5 ?for 127 C? atoms between structures in the complex form (PDB IDs: 1MUT ...
2 5vcu - http://www.japsonline.com/admin/php/uploads/2894_pdf.pdf In-silico study of flavonoids from Cassia tora as potential anti-psoriatic agent 2019 I Akachukwu, EE Amara- Journal of Applied Pharmaceutical, 2019 - japsonline.com 4; CCS ( PDB 5QC5) cathepsin S; JAK-3 ( PDB 5TTS) Janus kinase; RAC-1 ( PDB 5VCU ) Ras-related a vital structural requirement for strong binding with the target proteins The validity of the suggested structure - activity relationship is predicated on the observed reduction of
3 3t7c 3pgx http://www.ir.juit.ac.in:8080/jspui/handle/123456789/23859 Identification of Genes Involved in IN VIVO Virulence of Mycobacterium Fortuitum as Potential Drug Target 2020 R Srivastava - 2020 - ir.juit.ac.in acidic, hypoxic and detergent stress conditions. Structural and functional characterization of most potent ORF Mfsdr was done using in silico approaches. MfSdr was predicted to be acid synthesis. Secondary structure of MfSdr generated using Robetta server showed presence
4 3uam - http://www.ir.juit.ac.in:8080/jspui/bitstream/123456789/16581/1/SP13412_RADHIKA%... Computational Studies on Substrate Specificity in Lytic Polysaccharide Monooxygenases 2018 R Arora, RM Yennamalli - 2018 - ir.juit.ac.in 4ALS, 4ALT), Burkholderia pseudomallei CBM33 ( PDB ID: 3UAM ) [10], Bacillus coelicolor CBM2 ( PDB ID: 4OY7), Cellvibrio japonicas CBP33 ( PDB ID: 5FJQ). Page 17. 3 1.5 LPMO and substrate interactions Due to the binding of copper LPMO structure gets stabilized
5 3uf8 3vaw http://www.intelligentmodelling.org.uk/Projects/lingwei/lingwei-final.pdf A Research on the Use of Voxel Tessellations in the Representation, Investigation and Identification of Protein Surface Atoms and Binding Sites 2012 LL Wei - 2012 - intelligentmodelling.org.uk ... 110 5-13 Visualisations for identified dock site of protein 3UF8 from both RCSB PDB and thevoxel-based method, ... The increasing number of entries being deposited into the Protein DataBank (PDB) ... al, 2007) gives a comprehensive ordering of all proteins of known structure ...
6 3qh4 - http://www.intechopen.com/books/tuberculosis-current-issues-in-diagnosis-and-man... Lipid Inclusions in Mycobacterial Infections 2013 M Stehr, AA Elamin, M Singh - 2013 - intechopen.com ... Furthermore the three-dimensional structures of the esterases Rv0045c (PDB 3P2M) [78], Rv1847 (PDB 3S4K), and LipW (3QH4) from M. tuberculosis have been determined, but unfortunately it is not known whether these enzymes are involved in TAG hydrolysis. 3.5. ...
7 4iuj 4p9a, 3r2v, 3khw http://www.ingentaconnect.com/contentone/ben/cdth/2017/00000012/00000002/art0000... Current Drug Design Strategies for Fighting Against Swine Influenza 2017 M Alam, S Nandi- Current Drug Therapy, 2017 - ingentaconnect.com ... In-silico docking studies are at the fore front of structure based screening and designing of emerg- ing anti-swine ... PDB IDs of Crystal Structures ... 5D8U, 5D9J, 5DEB, 5DES, 5I13, 5CXR, 5FDD, 5FDG, 4ZQQ, 4ZHZ, 4ZI0, 4YYL, 4W9S, 4P9A, 4MK1, 4MK2, 4MK5, 4IUJ , 4F7M, 4AWK ...
8 4lfy - http://www.ingentaconnect.com/contentone/ben/cchts/2017/00000020/00000006/art000... Targeting Pyrimidine Pathway of Plasmodium knowlesi: New Strategies Towards Identification of Novel Antimalarial Chemotherapeutic Agents 2017 M Rashmi, MK Yadav, D Swati- Combinatorial chemistry & high, 2017 - ingentaconnect.com The structural quality factors and overall Z-scores of simulated PkDHOase structure were found within the valid limits, and thus may be used for drug design purposes Organism Query Coverage (%) Identity (%) PDB ID Burkholderia cenocepacia J2315 96 32 4LFY
9 3gaf - http://www.ingentaconnect.com/content/ben/ppl/2014/00000021/00000009/art00004 Carboxyl-Terminal and Arg38 are Essential for Activity of the 7α-Hydroxysteroid Dehydrogenase from Clostridium absonum 2014 D Lou, B Wang, J Tan, L Zhu - Protein and peptide letters, 2014 - ingentaconnect.com ... E. coli (Ec 7α-HSDH, PDB code: 1FMC) [21] and Brucella melitensis (PDB code: 3GAF) havebeen ... and arginine at position 37 of the human estro- genic 17β-HSDH (PDB code: 1QYV ... 38 isof vital importance, and the residue- replacement disrupts the normal structure for cofactor ...
10 3uw3 - http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin 2016 P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ...