We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 6MDY | 2018 | 0 |
| 6MFU | 2018 | 0 |
| 6MJK | 2018 | 0 |
| 6MQH | 2018 | 0 |
| 6MTZ | 2018 | 0 |
| 6N0U | 2018 | 0 |
| 6N0W | 2018 | 0 |
| 6N1M | 2018 | 0 |
| 3T5S | 2011 | 0 |
| 6NB0 | 2018 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 6amz | - | https://www.sciencedirect.com/science/article/pii/S002251932030028X | Identification of potential therapeutic targets in Neisseria gonorrhoeae by an in-silico approach | 2020 | P Tanwer, SRR Kolora, A Babbar, D Saluja- Journal of Theoretical, 2020 - Elsevier | The obtained protein. pdb file was overlapped with the homologous protein whose crystal structure ( 6AMZ from Acinetobacter baumannii) was obtained from RCSB database (Berman et al., 2000). Both protein structures were overlapped using Pymol (Alexander et al., 2011) to |
| 2 | 6an0 | - | https://www.mdpi.com/2076-2607/8/5/732 | The Role of Gene Elongation in the Evolution of Histidine Biosynthetic Genes | 2020 | S Del Duca, S Chioccioli, A Vassallo, LM Castronovo- Microorganisms, 2020 - mdpi.com | 6AN0 Elizabethkingia anophelis Amino acid sequences from HisA/HisF, IGPD, and HDH, available in the PDB , were downloaded from UniProt [29], aligned using BioEdit [30] through the ClustalW tool [31], and the conservation of the secondary structure organization was |
| 3 | 6ar7 | - | https://www.mlsb.io/papers/MLSB2020_Learning_Super-Resolution_Electron_Density.p... | Learning Super-Resolution Electron Density Map of Proteins using 3D U-Net | 2020 | B Mullick, Y Wang, P Yadav, AB Farimani - mlsb.io | The mesh grid displays the electron density surface for the structure and the underlying line diagram represents the protein structure from the PDB file. (a) The electron density map of PDB ID: 6AR7 (Green), with resolution of 2.10 |
| 4 | 6bfu | - | https://journals.asm.org/doi/abs/10.1128/jvi.01301-20 | Cryo-electron microscopy structure of the swine acute diarrhea syndrome coronavirus spike glycoprotein provides insights into evolution of unique coronavirus spike | 2020 | H Guan, Y Wang, V Perulija, AFUH Saeed- Journal of, 2020 - Am Soc Microbiol | HCoV-NL63 ( PDB accession number 5SZS); (C) S trimer of the deltacoronavirus PdCoV ( PDB accession number 6BFU ); (D) S bronchitis virus (IBV) ( PDB accession number 6CV0); (E) S trimer of the betacoronavirus SARS-CoV ( PDB accession number 5X58 (F) Structure of the |
| 5 | 6bfu | - | https://www.nature.com/articles/s41594-020-0478-5 | A thermostable, closed SARS-CoV-2 spike protein trimer | 2020 | X Xiong, K Qu, KA Ciazynska, M Hosmillo- Nature Structural &, 2020 - nature.com | Structures of the disulfide-stabilized and non-disulfide-stabilized proteins reveal distinct closed and locked conformations of the S trimer with the target cell, and is a dominant target of the immune system 4 . S protein is trimeric and has two distinct structural statesprefusion ... porcine deltacoronavirus (PDCoV, a deltacoronavirus, PDBID: 6BFU). S proteins are structurally aligned based on S2. S protein trimers from all 4 genera of |
| 6 | 6nb3 | 6nb7, 6nb4, 6nb6, 6vyb, 6vxx | https://link.springer.com/article/10.1007/s00018-020-03580-1 | Protein structure analysis of the interactions between SARS-CoV-2 spike protein and the human ACE2 receptor: from conformational changes to novel | 2020 | I Mercurio, V Tragni, F Busto, A De Grassi- Cellular and Molecular, 2020 - Springer | Download PDF. Download PDF. Original Article; Published: 04 July 2020. Protein structure analysis of the interactions between SARS-CoV-2 spike protein and the human ACE2 receptor: from conformational changes to novel neutralizing antibodies |
| 7 | 6c49 | - | https://link.springer.com/article/10.1007/s12010-020-03400-z | In silico study of the structure and ligand interactions of alcohol dehydrogenase from cyanobacterium Synechocystis Sp. PCC 6803 as a key enzyme for biofuel | 2020 | O Haghighi, M Moradi- Applied Biochemistry and Biotechnology, 2020 - Springer | with amino acids in Zn ion binding sites along with a slight deviation between Cys 110 in the template and Cys 106 in the homology model in the location of structural Zn PCC 6803 homology model (Cyan) superimposed onto the template crystal structure ( PDB ID: 6C49 ) (Tan |
| 8 | 6c6b | - | https://www.sciencedirect.com/science/article/pii/S0141813020344470 | Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina | 2020 | FOS Ribeiro, GS de Arajo, MGA Mendes- International Journal of, 2020 - Elsevier | Volume 165, Part A, 15 December 2020, Pages 279-290. International Journal of Biological Macromolecules. Structural characterization, antifungal and cytotoxic profiles of quaternized heteropolysaccharide from Anadenanthera colubrina The 3D structures of all possible C. neoformans and M. canis targets were obtained from the Protein Data Bank (PDB) (Protein Data Bank, 2019) with the codes 2W3N (Carbonic anhydrase 2), 3Q73 (Farnesyl transferase), 5I33 (Adenylosuccinate synthetase), 5 U29 (Acetyl-coenzyme |
| 9 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 10 | 6cfp | - | https://www.tandfonline.com/doi/abs/10.1080/07391102.2020.1806112 | New anti-viral drugs for the treatment of COVID-19 instead of favipiravir | 2020 | A Akta, B Tzn, R Aslan, K Sayin- Biomolecular Structure, 2020 - Taylor & Francis | According to Table 2, the 6CFP protein is not inhibited by any ligands RNA polymerase proteins with PDB IDs of 6NUR and 6NUS were reported in late 2019 and early In this calculation, the ligand and protein are flexible and solvent molecules surround the entire structure |