We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 6W2O | 2020 | 0 |
| 6W15 | 2020 | 0 |
| 6VS4 | 2020 | 0 |
| 6VH5 | 2020 | 0 |
| 6V91 | 2020 | 0 |
| 6V77 | 2020 | 0 |
| 6V45 | 2019 | 0 |
| 9YRW | 2025 | 0 |
| 6UWQ | 2020 | 0 |
| 6ULO | 2019 | 0 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 4tu1 | - | http://www.jbc.org/content/early/2017/09/27/jbc.M117.811034.abstract | Isomer Activation Controls Stereospecificity of Class I Fructose-1, 6-bisphosphate Aldolases | 2017 | PW Heron, J Sygusch- Journal of Biological Chemistry, 2017 - ASBMB | At the structural level, there is complete conservation of the subunit beta-barrel fold 1A) corresponds to an active site fully occupied by FBP that super- poses identically with the FBP bound structure of the rabbit homolog [ PDB ID: 1ZAI] (rms devia- tion = 0.41 based on |
| 2 | 3uw3 | - | http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 | Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin | 2016 | P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com | A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ... |
| 3 | 3gbz | - | http://www.sciencedirect.com/science/article/pii/S0022283613004518 | The N-terminal extension of UBE2E ubiquitin conjugating enzymes limits chain assembly | 2013 | FR Schumacher, G Wilson, CL Day - Journal of molecular biology, 2013 - Elsevier | ... (a) Overlay of the core domain of UBE2E1 (3GBZ) onto the structure of UBE2D2~Ub conjugate (PDB: 3A33). The interaction between ubiquitin from one molecule, shown as a ribbon (teal) and a surface, and the backside of UBE2D2 (teal ribbon) is shown. ... |
| 4 | 3i3r | 3nrr | https://www.cell.com/molecular-plant/abstract/S1674-2052(25)00209-6 | Structural insights into a plant-conserved DHFR-TS reveal a selective herbicide target | 2025 | J Haywood, KJ Breese, DP McDougal, C Verdonk- Molecular Plant, 2025 - cell.com | A molecular replacement model was generated based on the last common atom of PDB 3I3R and the structure solved with PHASER from CCP4100. Manual building and refinement |
| 5 | 5i1f | - | http://scripts.iucr.org/cgi-bin/paper?dp5104 | Structure of the Bacillus anthracis dTDP-l-rhamnose-biosynthetic enzyme glucose-1-phosphate thymidylyltransferase (RfbA) | 2017 | J Baumgartner, J Lee, AS Halavaty- Section F: Structural, 2017 - scripts.iucr.org | The Mg2+ ion is modeled from the RffH structure The GalU homologs are from Burkholderia vietnamiensis ( PDB entry 5i1f ; Seattle Structural Genomics Center for Infectious Disease, unpublished work) and Sphingomonas elodea ( PDB entry 2ux8), respectively |
| 6 | 3qh4 | - | https://www.biorxiv.org/content/10.1101/2021.02.23.432567v1.abstract | Structure guided engineering of a cold active esterase expands substrate range though a stabilisation mutation that allows access to a buried water chamber | 2021 | N Noby, R Johnson, J Tyzack, A Embaby, H Saeed- bioRxiv, 2021 - biorxiv.org | to fully open the HerE plug. LipW ( PDB 3QH4 ) (26) has two shorter residues in place PestE ( PDB 2YH2) (28) does not have the plug (Figure 2b). N211 is replaced by a of helical character than the WT suggesting a higher degree of structure for the mutant at this temperature |
| 7 | 3ue9 | - | http://scripts.iucr.org/cgi-bin/paper?S1744309113021921 | Purification, crystallization and preliminary X-ray analysis of adenylosuccinate synthetase from the fungal pathogen Cryptococcus neoformans | 2013 | RD Blundell, SJ Williams, CA Morrow? - Acta Crystallographica Section F Structural Biology and Crystallization Communications, 2013 - scripts.iucr.org | ... Zhou, S. Peterson, W. Anderson & A. Joachimiak, unpublished work), Campylobacter jejuni (43% identity; PDB entry 3r7t ; Center for Structural Genomics of Infectious Diseases, unpublished work) and Burkholderia thailandensis (40% identity; PDB entry 3ue9 ; Seattle Structural ... |
| 8 | 4ohc | - | http://dspace.ncl.res.in:8080/xmlui/bitstream/handle/20.500.12252/2071/TH2183.pd... | Investigations into patterns of interactions involving sequentially neighboring amino acids in functional proteins | 2016 | M Sule - 2016 - dspace.ncl.res.in | Figure 6. The alpha helix in PDB : 3KB9 with the side chain hydrogen bonding pattern between While most motifs comprise primarily of regular secondary structures such as -helices or -sheets, the regions connecting these structural elements are irregular structure elements |
| 9 | 6c9c | - | https://www.biorxiv.org/content/10.1101/863571v1.abstract | Disorder and interfaces in proteins are two sides of the same coin | 2019 | B Seoane, A Carbone- bioRxiv, 2019 - biorxiv.org | c. Analysis of cluster 6c9c A ( PDB IDs for the structures are given in SI section S2). In the external wheel, we show one unbound structure and the chain structures containing the 12 different interfaces of this cluster: DRs in orange and IRs in blue |
| 10 | 5ez3 | - | https://www.mdpi.com/1422-0067/21/15/5391 | Characterization of the Proteins Involved in the DNA Repair Mechanism in M. smegmatis | 2020 | A Di Somma, C Can, A Moretta, A Cirillo- International journal of, 2020 - mdpi.com | The primary structure of the recombinant protein was verified by MALDI mapping strategy (Supplementary Materials, Table S4) and its correct folding assessed by circular The Acyl-CoA dehydrogenase from Brucella melitensis in complex with FAD ( PDB code 5EZ3 A) was |