We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 3V9P | 2012 | 2 |
| 6PTG | 2019 | 2 |
| 3HN6 | 2009 | 2 |
| 5W15 | 2017 | 2 |
| 3LP8 | 2010 | 2 |
| 7KXA | 2020 | 2 |
| 3U7J | 2011 | 2 |
| 3U0F | 2011 | 2 |
| 3TZQ | 2011 | 2 |
| 5VOG | 2017 | 2 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 4ege | - | http://scripts.iucr.org/cgi-bin/paper?no5060 | Crystallization and preliminary X-ray diffraction analysis of Xaa-Pro dipeptidase from Xanthomonas campestris | 2014 | A Kumar, VN Are, B Ghosh, U Agrawal - Section F: Structural , 2014 - scripts.iucr.org | ... Although the structures of XPD43 orthologues from the eubacteria Mycobacterium ulcerans, Bacillus anthracis and Thermotoga maritima (PDB entries 4ege , 3q6d and 2zsg ) have been deposited in the PDB by structural genomics consortia, none of these enzymes have been ... |
| 2 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 3 | 4f2n | - | https://www.mdpi.com/2223-7747/9/8/983 | Three Alkaloids from an Apocynaceae Species, Aspidosperma spruceanum as Antileishmaniasis Agents by In Silico Demo-case Studies | 2020 | D Morales-Jadn, J Blanco-Salas, T Ruiz-Tllez- Plants, 2020 - mdpi.com | of this method can provide insights into the druggable targetome contained in the structural proteome criteria were chosen (vg to be a starting structure , to have a similar structure of a drawn using Marvin Sketch 19.15 converting the format of some structures into pdb files using ... Table A2. Enzymes crystal structures available in PDB server. 4f2n.1.A target SOD |
| 4 | 4g67 | 4f3n | https://www.degruyter.com/view/j/bchm.2019.400.issue-11/hsz-2019-0182/hsz-2019-0... | Exceptionally versatilearginine in bacterial post-translational protein modifications | 2019 | J Lassak, F Koller, R Krafczyk, W Volkwein- Biological chemistry, 2019 - degruyter.com | Post-translational modifications (PTM) are the evolutionary solution to challenge and extend the boundaries of genetically predetermined proteomic diversity. As PTMs are highly dynamic, they also hold an enormous regulatory potential. The Mitochondrial Dysfunction protein A (MidA), a PRMT from Dictyostelium discoideum shows structural similarities to the putative protein Q6N1P6 (PDB: 1ZKD) of Rhodopseudomonas palustris and two other hypotheticals (PDB: 4F3N, 4G67) (Baugh et al., 2013) from Burkholderia |
| 5 | 6ona | - | https://onlinelibrary.wiley.com/doi/abs/10.1111/tbed.13944 | Evolution of H9N2 avian influenza viruses in Iran, 20172019 | 2020 | M Bashashati, DH Chung- Transboundary and, 2020 - Wiley Online Library | (http://www.cbs.dtu.dk/services/NetNGlyc/) and GlyProt server (http://www.glycosciences.de/ modeling/). The HA structure was modelled using the H9 HA template ( PDB accession number, 6ONA ) in the SWISS-MODEL server (https://swissmodel.expasy.org/) and |
| 6 | 6b8s | - | https://www.sciencedirect.com/science/article/pii/S0005272822004182 | Unveiling the membrane bound dihydroorotate: Quinone oxidoreductase from Staphylococcus aureus | 2023 | FM Sousa, P Pires, A Barreto, PN Refojo- et Biophysica Acta (BBA, 2023 - Elsevier | Because of the low solubility of this molecule, we used a structural menaquinone analogue lacking the aliphatic carbon tail, dimethyl-naphthoquinone (DMN). The enzyme showed a ... |
| 7 | 6q09 | - | https://pubs.acs.org/doi/abs/10.1021/acsomega.0c03338 | Correlation of Conservation of Sequence and Structures of Mycobacterial Hemerythrin-like Proteins with Evolutionary Relationship and Host Pathogenicity | 2020 | Z Ma, ML Caldas Nogueira, DP Marchi-Salvador- ACS, 2020 - ACS Publications | Journal Logo. Correlation of Conservation of Sequence and Structures of Mycobacterial Hemerythrin-like Proteins with Evolutionary Relationship and Host Pathogenicity. Zhongxin Ma Zhongxin Ma. Burnett School of Biomedical |
| 8 | 3gbz | - | https://pubs.rsc.org/en/content/articlehtml/2020/me/c9me00097f | How evolution designs functional free energy landscapes of proteins? A case study on emergence of regulation in CDK family kinases. | 2020 | Z Shamsi, D Shukla- Molecular Systems Design & Engineering, 2020 - pubs.rsc.org | structures of CDK2 ( PDB ID: 5OSM, 6Q3F, 6Q4A, 6Q4B, 6Q4C, 6Q4D, 6Q4K), G/CDK ( PDB ID: 3GBZ ), and pfpk5 structures are native-like based on GA341 score and have comparable DOPE score with CDK2 native structure as shown in PDB ID for CMGI for native CDK2 score |
| 9 | 3jst | - | https://www.sciencedirect.com/science/article/pii/S0141813020335261 | Role of tetrachloro-1, 4-benzoquinone reductase in phenylalanine hydroxylation system and pentachlorophenol degradation in Bacillus cereus AOA-CPS1 | 2020 | OA Aregbesola, A Kumar, MP Mokoena- International Journal of, 2020 - Elsevier | Three-dimensional structure and homology modelling of the protein were predicted by submitting the amino acid sequence at the SWISS-MODEL tool at The modelled PDB files were submitted to an online tool (PDBsum) for determining the structural summary [34]. 2.12 ... and sequence identity of 59%, followed by PCD/DCoH (PDB: 3JST) from Brucella melitensis, |
| 10 | 5vir | 4fry, 4ymi | https://pubs.acs.org/doi/abs/10.1021/acsinfecdis.0c00735 | Structural and Molecular Dynamics of Mycobacterium tuberculosis Malic Enzyme, a Potential Anti-TB Drug Target | 2020 | KH Burley, BJ Cuthbert, P Basu- ACS Infectious, 2020 - ACS Publications | \ Interestingly, the three top-scoring NADP+ molecules are found in structures of Mtb nicotinamide-mononucleotide adenylyltransferase (NadD) (PDB ID: 4S1O) and Mycobacterium abscessus NadD (PDB ID: 4YMI and 5VIR). These results |