SSGCID
Seattle Structural Genomics Center for Infectious Disease

Cited Structures: list of articles citing SSGCID structures

We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.

This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.

Cited structures

Manually reviewed citations

# PDB Additional SSGCID structures cited Link Title Year Citation Highlighted abstract
1 3rqi - http://pubs.acs.org/doi/full/10.1021/bi301004v A Predicted Structure for the PixD-PixE Complex Determined by Homology Modeling, Docking Simulations, and a Mutagenesis Study 2013 S Ren, R Sato, K Hasegawa, H Ohta, S Masuda - Biochemistry, 2013 - ACS Publications ... PixE Homology Modeling The amino acid sequence of PixE was obtained from the DNA DataBank of Japan (entry ... were bacterial response regulators (best 20 defined as those with the smallest E values; PDB entries 3LUF, 3N0R, 3GT7, 1QKK, 3KHT, 3RQI, 2ZQT, 2QZJ ...
2 4wny - https://www.biorxiv.org/content/10.1101/2020.10.03.324806v1.abstract A Universal Stress Protein upregulated by hypoxia may contribute to chronic lung colonisation and intramacrophage survival in cystic fibrosis 2020 A O'Connor, R Berisio, M Lucey, K Schaffer, S McClean- bioRxiv, 2020 - biorxiv.org abilities. 253 To identify structural determinants responsible for the different behaviours of USP76 and 254 USP92, in particular their different abilities to bind to epithelial cells, we used homology 255 modelling and analysed resulting structures the best template was the BupsA stress protein from Burkholderia pseudomallei (PDB code 563 4wny, seqid 69.2%).
3 5td3 - https://www.jstage.jst.go.jp/article/jgam/advpub/0/advpub_2019.06.002/_article/-... Cloning, expression and characterization of catechol 1, 2-dioxygenase from Burkholderia cepacia 2019 TVN Thi, DDH Sinh, THT Le, ND Huy- The Journal of general, 2019 - jstage.jst.go.jp Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: 337 quantitative structure /activity relationship and the crystal structures of native enzyme 338 radioresistens LMG S13 ( PDB : 2XSU), B. vietnamiensis LMG 22486 ( PDB : 5TD3 ), R. 375
4 3ek2 - https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5401771/ Rational Optimization of Diphenyl Ether Binding Kinetics to the Enoyl-ACP Reductase FabI1 from Burkholderia pseudomallei 2017 C Neckles, S Eltschkner, JE Cummings- Biochemistry, 2017 - ncbi.nlm.nih.gov 35 The structures were solved by molecular replacement with Phaser 36 utilizing either the apo structure of bpFabI1 ( PDB entry 3EK2 ), or the complex structure of bpFabI1 with PT155 ( PDB entry 4BKU) as search model
5 3cez - http://www.springerlink.com/index/E032J772125W08T2.pdf 1 H, 13 C and 15 N resonance assignment of a zinc-binding methionine sulfoxide reductase type-B from the thermophilic archeabacterium Methanothermobacter thermoautotrophicus 2010 M Carella, O Ohlenschl?ger, R Ramachandran? - Biomolecular NMR Assignments, 2010 - Springer ... 2) as predicted from chemical shifts by using TALOS+ (Shen et al. 2009) are in close agreement with the ones present in other known MSRB structures (eg PDB 3HCJ, 3CEZ, 1L1D). The 13Ca and 13Cb chemical shifts suggested (Kornhaber et al. ...
6 3enk - http://www.sciencedirect.com/science/article/pii/S0003269710007165 Highly selective l-threonine 3-dehydrogenase from< i> Cupriavidus necator</i> and its use in determination of l-threonine 2011 T Ueatrongchit, Y Asano - Analytical Biochemistry, 2011 - Elsevier ... BaGluE, UDP-glucose 4-epimerase from Bacillus anthracis (2C20); BpGluE, UDP-glucose 4-epimerase from Burkholderia pseudomallei (3ENK); SvDHT, DTDP-glucose 4,6-dehydratase from Streptomyces venezuelae (1R66); ...
7 4ywj - https://onlinelibrary.wiley.com/doi/abs/10.1002/prot.25574 Coil conversion to strand induced by dimerization 2018 J Laibe, A Caffrey, M Broutin, S Guiglion- Proteins: Structure, 2018 - Wiley Online Library CATH: an expanded resource to predict protein function through structure and sequence -strand interfaces, standard - strand interfaces and domains in CATH (based on PDB release: July 01 interface including a salt bridge between E226-A and H232-B ( 4YWJ ) B. Dimorphic
8 3qxz - https://link.springer.com/article/10.1007/s12257-018-0393-3 Crystal Structure of a Novel Type Isomerase of Enoyl-CoA Hydratase/Isomerase Family Protein from Cupriavidus necator H16 2019 H Seo, KJ Kim- Biotechnology and Bioprocess Engineering, 2019 - Springer code 5Z7R, Z-score 31.5 and 1.7 rmsd) and probable enoyl- CoA hydratase/isomerase from Mycobacterium abscessus ( PDB code 3QXZ , Z-score has highly conserved enoyl-CoA hydratase fold but its functional implication cannot be obtained from the overall structure
9 3i44 - https://journals.plos.org/plosone/article/file?type=printable&id=10.1371/journal... Understanding the impacts of missense mutations on structures and functions of human cancer-related genes: A preliminary computational analysis of the 2019 S Malhotra, AF Alsulami, Y Heiyun, BM Ochoa, H Jubb- PloS one, 2019 - journals.plos.org We modeled the structure the transmembrane domain and the missing regions between the kinase domain and the transmembrane residue range: 191239, using ( PDB IDs: 1H4I, 3I44 , and 1H4J) as We then mapped the mutation data on to the modeled structure (Fig 6A)
10 3uw3 - http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin 2016 P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ...