We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 6MJN | 2018 | 2 |
| 6MWJ | 2019 | 2 |
| 4ZDQ | 2015 | 2 |
| 3GP3 | 2009 | 2 |
| 4J3G | 2013 | 2 |
| 4JGA | 2013 | 2 |
| 4IWH | 2013 | 2 |
| 4JV3 | 2013 | 2 |
| 3V9P | 2012 | 2 |
| 6DBB | 2018 | 2 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 6n38 | - | https://www.sciencedirect.com/science/article/pii/S0022283622005447 | Coevolution-Guided Mapping of the Type VI Secretion Membrane Complex-Baseplate Interface | 2023 | E Vanliolu, YG Santin, I Filella-Merce- Journal of Molecular, 2023 - Elsevier | the EAEC T6SS wedge complex structure 10 as a benchmark in a The known structure of the wedge complex ( PDB : 6N38 ) was AlphaFold2 structural models were generated using the |
| 2 | 3gbz | - | https://pubs.rsc.org/en/content/articlehtml/2020/me/c9me00097f | How evolution designs functional free energy landscapes of proteins? A case study on emergence of regulation in CDK family kinases. | 2020 | Z Shamsi, D Shukla- Molecular Systems Design & Engineering, 2020 - pubs.rsc.org | structures of CDK2 ( PDB ID: 5OSM, 6Q3F, 6Q4A, 6Q4B, 6Q4C, 6Q4D, 6Q4K), G/CDK ( PDB ID: 3GBZ ), and pfpk5 structures are native-like based on GA341 score and have comparable DOPE score with CDK2 native structure as shown in PDB ID for CMGI for native CDK2 score |
| 3 | 3qbp | 3qh8 | http://dl.acm.org/citation.cfm?id=2213792 | Protein surface characterization using an invariant descriptor | 2011 | ZA Deeb, DA Adjeroh, BH Jiang - Journal of Biomedical Imaging, 2011 - dl.acm.org | ... 1. Introduction The Protein Data Bank (http://www.pdb.org/pdb/home/ home.do) (PDB) currently has more than 3000 protein struc- tures classified as uncharacterized or as proteins of unknown function. This is about 5% of the total structures in PDB. ... |
| 4 | 4fkx | - | https://www.sciencedirect.com/science/article/pii/S0006291X1930155X | Characterization of crystal structure and key residues of Aspergillus fumigatus nucleoside diphosphate kinase | 2019 | Y Hu, X Jia, Z Lu, L Han- Biochemical and biophysical research, 2019 - Elsevier | was determined by molecular replacement (MR) method using Trypanosoma brucei NDK (TbNDK, PDB code 4FKX ) as starting The PDB accession code was 6AGY 1230-1247. Google Scholar. [9] L. Moynie, MF Giraud, F. Georgescauld, I. Lascu, A. DautantThe structure of the |
| 5 | 3eiy | - | https://www.biorxiv.org/content/10.1101/2020.07.15.204701v1.abstract | Graphein-a Python Library for Geometric Deep Learning and Network Analysis on Protein Structures | 2020 | AR Jamasb, P Li, T Blundell- bioRxiv, 2020 - biorxiv.org | Figure 1. Example outputs from Graphein. A Example protein surface ( 3eiy ). B Example node feature matrix for the residue-level graphs outlined The interaction status data and structure originate from structures of the complexes in the RCSB PDB |
| 6 | 4wxt | - | https://www.sciencedirect.com/science/article/pii/S014181301830610X | Inhibition of thioredoxin A1 from Corynebacterium pseudotuberculosis by polyanions and flavonoids | 2018 | RJ Eberle, LA Kawai, FR de Moraes, D Olivier- International journal of, 2018 - Elsevier | The initial model of the Cp-TrxA1 protein was obtained by homology modeling with the M. avium Trx structure ( PDB : 4WXT ; 50% homology), in order to Structural superposition of the Cp-TrxA1 homology model and the M. avium Trx structure showed a RMSD of 0.188 (Fig |
| 7 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 8 | 4ywj | 4f3y, 3ijp | https://portlandpress.com/biochemj/article-abstract/475/1/137/50160 | Plant DHDPR forms a dimer with unique secondary structure features that preclude higher-order assembly | 2018 | SAJ Watkin, JR Keown, E Richards- Biochemical, 2018 - portlandpress.com | DHDPR from a total of nine bacterial species, whereas no plant DHDPR structures were previously and X-ray crystallography to demonstrate how small elements of secondary structure are able Additionally, we use kinetic assays and an analysis of the structural flexibility of the |
| 9 | 6bfu | - | https://www.nature.com/articles/s41467-024-49693-0 | Neutralizing antibodies reveal cryptic vulnerabilities and interdomain crosstalk in the porcine deltacoronavirus spike protein | 2024 | W Du, O Debski-Antoniak, D Drabek- Nature, 2024 - nature.com | the antigenic structure of the PDCoV S protein. Through functional and structural characterization The PDB file of PDCoV spike protein ( PDB ID: 6BFU ) and SARS-CoV-2 spike protein ( |
| 10 | 7jva | - | https://www.nature.com/articles/s41467-023-35949-8.pdf | Structural basis for a conserved neutralization epitope on the receptor-binding domain of SARS-CoV-2 | 2023 | KYA Huang, X Chen, A Mohapatra- Nature, 2023 - nature.com | PDB code 7M7B for 3D11 and 7JVA for S2A4. c IS-9A and similar antibodies extend their footprints upwards and contact residue 408 and the residues 502-504 region. |