SSGCID
Seattle Structural Genomics Center for Infectious Disease

Cited Structures: list of articles citing SSGCID structures

We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.

This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.

Cited structures

Manually reviewed citations

# PDB Additional SSGCID structures cited Link Title Year Citation Highlighted abstract
1 6n38 - https://www.sciencedirect.com/science/article/pii/S0022283622005447 Coevolution-Guided Mapping of the Type VI Secretion Membrane Complex-Baseplate Interface 2023 E Vanliolu, YG Santin, I Filella-Merce- Journal of Molecular, 2023 - Elsevier the EAEC T6SS wedge complex structure 10 as a benchmark in a The known structure of the wedge complex ( PDB : 6N38 ) was AlphaFold2 structural models were generated using the
2 4wxt - https://www.sciencedirect.com/science/article/pii/S014181301830610X Inhibition of thioredoxin A1 from Corynebacterium pseudotuberculosis by polyanions and flavonoids 2018 RJ Eberle, LA Kawai, FR de Moraes, D Olivier- International journal of, 2018 - Elsevier The initial model of the Cp-TrxA1 protein was obtained by homology modeling with the M. avium Trx structure ( PDB : 4WXT ; 50% homology), in order to Structural superposition of the Cp-TrxA1 homology model and the M. avium Trx structure showed a RMSD of 0.188 (Fig
3 4fkx - https://www.sciencedirect.com/science/article/pii/S0006291X1930155X Characterization of crystal structure and key residues of Aspergillus fumigatus nucleoside diphosphate kinase 2019 Y Hu, X Jia, Z Lu, L Han- Biochemical and biophysical research, 2019 - Elsevier was determined by molecular replacement (MR) method using Trypanosoma brucei NDK (TbNDK, PDB code 4FKX ) as starting The PDB accession code was 6AGY 1230-1247. Google Scholar. [9] L. Moynie, MF Giraud, F. Georgescauld, I. Lascu, A. DautantThe structure of the
4 3gbz - https://pubs.rsc.org/en/content/articlehtml/2020/me/c9me00097f How evolution designs functional free energy landscapes of proteins? A case study on emergence of regulation in CDK family kinases. 2020 Z Shamsi, D Shukla- Molecular Systems Design & Engineering, 2020 - pubs.rsc.org structures of CDK2 ( PDB ID: 5OSM, 6Q3F, 6Q4A, 6Q4B, 6Q4C, 6Q4D, 6Q4K), G/CDK ( PDB ID: 3GBZ ), and pfpk5 structures are native-like based on GA341 score and have comparable DOPE score with CDK2 native structure as shown in PDB ID for CMGI for native CDK2 score
5 3qbp 3qh8 http://dl.acm.org/citation.cfm?id=2213792 Protein surface characterization using an invariant descriptor 2011 ZA Deeb, DA Adjeroh, BH Jiang - Journal of Biomedical Imaging, 2011 - dl.acm.org ... 1. Introduction The Protein Data Bank (http://www.pdb.org/pdb/home/ home.do) (PDB) currently has more than 3000 protein struc- tures classified as uncharacterized or as proteins of unknown function. This is about 5% of the total structures in PDB. ...
6 3eiy - https://www.biorxiv.org/content/10.1101/2020.07.15.204701v1.abstract Graphein-a Python Library for Geometric Deep Learning and Network Analysis on Protein Structures 2020 AR Jamasb, P Li, T Blundell- bioRxiv, 2020 - biorxiv.org Figure 1. Example outputs from Graphein. A Example protein surface ( 3eiy ). B Example node feature matrix for the residue-level graphs outlined The interaction status data and structure originate from structures of the complexes in the RCSB PDB
7 6bfu - https://www.nature.com/articles/s41467-024-49693-0 Neutralizing antibodies reveal cryptic vulnerabilities and interdomain crosstalk in the porcine deltacoronavirus spike protein 2024 W Du, O Debski-Antoniak, D Drabek- Nature, 2024 - nature.com the antigenic structure of the PDCoV S protein. Through functional and structural characterization The PDB file of PDCoV spike protein ( PDB ID: 6BFU ) and SARS-CoV-2 spike protein (
8 7jva - https://www.nature.com/articles/s41467-023-35949-8.pdf Structural basis for a conserved neutralization epitope on the receptor-binding domain of SARS-CoV-2 2023 KYA Huang, X Chen, A Mohapatra- Nature, 2023 - nature.com PDB code 7M7B for 3D11 and 7JVA for S2A4. c IS-9A and similar antibodies extend their footprints upwards and contact residue 408 and the residues 502-504 region.
9 6c87 - https://www.sciencedirect.com/science/article/pii/S1878818119318249 In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family 2020 N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16
10 6pqh - https://www.sciencedirect.com/science/article/pii/S0969212621001647 Structural study of the N-terminal domain of human MCM8/9 complex 2021 J Li, D Yu, L Liu, H Liang, Q Ouyang, Y Liu- Structure, 2021 - Elsevier Journal home page for Structure . Article. Structural study of the N-terminal domain of human MCM8/9 complex Show more Share. Cite Highlights. The heterohexameric NTD structure combined crystal structures with cryo-EM map. ...Some other structures with less than 2.0 Å RMSD include DNA-directed DNA polymerase III (PDB: 3F2B), asparagine-tRNA ligase (PDB: 6PQH), replication protein A (PDB: 2K5V), telomerase-associated protein