We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 2LXF | 2012 | 2 |
| 7L3Q | 2020 | 2 |
| 7LXI | 2021 | 2 |
| 5JAY | 2016 | 2 |
| 7KN1 | 2020 | 2 |
| 7LD8 | 2021 | 2 |
| 3HN6 | 2009 | 2 |
| 6UK3 | 2019 | 2 |
| 6U79 | 2020 | 2 |
| 7JWK | 2020 | 2 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 3eg4 | - | http://dx.plos.org/10.1371/journal.pone.0031133 | Tetrahydrodipicolinate N-Succinyltransferase and Dihydrodipicolinate Synthase from Pseudomonas aeruginosa: Structure Analysis and Gene Deletion | 2012 | R Schnell, W Oehlmann, T Sandalova, Y Braun? - PloS one, 2012 - dx.plos.org | ... In addition, the coordinates for DapD from Campylobacter jejuni (2RIJ), Enterococcus feacalis (3CJ8), Brucella melitensis (3EG4), and Yersinia ... model of the trimer of the putative tetrahydropyridine-2-carboxylate N-succinyltransferase from Campylobacter jejuni (PDB code ... |
| 2 | 6q06 | - | https://academic.oup.com/femsre/advance-article-abstract/doi/10.1093/femsre/fuaa... | Molecular diversity of coronavirus host cell entry receptors | 2020 | JK Millet, JA Jaimes, GR Whittaker- FEMS microbiology reviews, 2020 - academic.oup.com | boxes indicate genes encoding accessory proteins (ns2, ns4a, ns4b and ns5a), while green boxes indicate structural proteins B) Representative structure of coronavirus protein in pre-fusion (S1 and S2 subunits, PDB 3JCL) and post-fusion (S2 subunit, PDB 6B3O) conformations ...MERS-CoV NTD (PDB 6Q06), which binds sialosides with a preference for α2,3-linked sialic acids, |
| 3 | 5upg | - | https://www.sciencedirect.com/science/article/pii/S0141813018328204 | The inhibitory and binding studies of methyl-sulfone hydroxamate based inhibitors against LpxC from drug resistant Moraxella catarrhalis using biophysical | 2018 | A Sharma, V Kumar, S Pratap, P Kumar- International journal of biological, 2018 - Elsevier | Similarly, a crystal structure of LpxC from P. aeruginosa complexed with the LpxC-4 inhibitors (PDB ID: 5UPG) have also shown the interactions of ligand at these two sites. |
| 4 | 7jw0 | - | https://pubs.acs.org/doi/abs/10.1021/acs.jctc.1c00372 | Dynamic Profiling of Binding and Allosteric Propensities of the SARS-CoV-2 Spike Protein with Different Classes of Antibodies: Mutational and Perturbation-Based | 2021 | G Verkhivker, S Agajanian, D Oztas- Journal of Chemical, 2021 - ACS Publications | The functional adaptability and conformational plasticity of SARS-CoV- 2 spike proteins allow for the efficient modulation of complex phenotypic responses to the host receptor and antibodies. In thi... |
| 5 | 3dah | - | http://link.springer.com/article/10.1007/s00792-014-0726-x | Structure of dimeric, recombinant Sulfolobus solfataricus phosphoribosyl diphosphate synthase: a bent dimer defining the adenine specificity of the substrate ATP | 2015 | RW Andersen, LL Leggio, B Hove-Jensen, A Kadziola - Extremophiles, 2015 - Springer | ... 1 3 structure of PRPP synthase of the thermophilic, metha- nogenic archaeon M. jannaschii istetrameric and appears to be built by two dimers ... 2007), and the Gram-negative Betaproteobacterium Burkholderia (Pseudomonas) pseudomallei (PDB code 3DAH) have hex ... |
| 6 | 3kw3 | - | http://scripts.iucr.org/cgi-bin/paper?S2053230X14017725 | The structure of alanine racemase from Acinetobacter baumannii | 2014 | E Davis, E Scaletti-Hutchinson - Section F: Structural , 2014 - scripts.iucr.org | ... Alanine racemase, PDB entry, Whole monomer #, N-terminal domain +, C-terminal domain , Active site ##. Alr Eco, 2rjg, 1.30 (41%), 1.32 (40%), 1.02 (43%), 0.65 (60%). Alr Bhe, 3kw3, 1.86 (29%), 1.68 (25%), 1.07 (36%), 0.91 (48%). ... |
| 7 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 8 | 4ex5 | - | http://dx.plos.org/10.1371/journal.pone.0096198 | Structural Basis for the Site-Specific Incorporation of Lysine Derivatives into Proteins | 2014 | V Flgel, M Vrabel, S Schneider - PloS one, 2014 - dx.plos.org | ... A structure of the LysRS from Bacillus stearothermophilus (PDB code 3A74), Bulkholderia thailandensis (PDB code 4EX5 [38]) and Escherichia coli (PDB ... Atomic coordinates were submitted to the Protein Data Bank (http://www.ebi.ac.uk/pdbe/) with the PDB codes: 4CH6 ... |
| 9 | 3hhj | - | http://www.sciencedirect.com/science/article/pii/S0006291X12004056 | Insights into substrate recognition by the< i> Escherichia coli</i> Orf135 protein through its solution structure | 2012 | K Kawasaki, T Kanaba, M Yoneyama? - Biochemical and Biophysical Research Communications, 2012 - Elsevier | ... Finally, this study should contribute towards a further understanding of the substrate specificity of Nudix enzymes. For example, the DALI server showed the highest similarity score of 18.9 to the recently published Nudix enzyme (PDB:3hhj) [27]. ... |
| 10 | 3nrr | - | http://onlinelibrary.wiley.com/doi/10.1111/febs.13662/full | Structural analysis of dihydrofolate reductases enables rationalization of antifolate binding affinities and suggests repurposing possibilities | 2016 | A Bhosle, N Chandra - FEBS Journal, 2016 - Wiley Online Library | ... due to conservation of overall structure makes it feasible to study variation at each ... C9 (P.falciparum:Tyr 57 and Phe 223; PDB ID: 1J3I), B.bovis (Phe 40 and Phe 161; PDB ID: 3NRR), C.hominis(Phe 35 and Phe 172; PDB ID: 3HJ3) and E.faecalis (Phe 30 and Tyr ... |