We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 6WCI | 2020 | 2 |
| 4F83 | 2012 | 2 |
| 7KXA | 2020 | 2 |
| 7L3Q | 2020 | 2 |
| 7LXI | 2021 | 2 |
| 7KNP | 2020 | 2 |
| 7SKB | 2021 | 2 |
| 3U7J | 2011 | 2 |
| 3U0F | 2011 | 2 |
| 8ERR | 2022 | 2 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 3pgz | - | http://link.springer.com/protocol/10.1007/978-1-62703-032-8_2 | Structural Diversity Based on Variability in Quaternary Association. A Case Study Involving Eubacterial and Related SSBs | 2012 | SM Arif, M Vijayan - Single-Stranded DNA Binding Proteins, 2012 - Springer | ... structures reported in the literature and/or the coordinates of which have been deposited in the Protein Data Bank (PDB) ( 17 ) form ... in the PDB, but the results are yet to be published: 1. Thermus thermophilus (TtSSB) (PDB code 2cwa). 2. Bartonella henselae (BhSSB) (3pgz). ... |
| 2 | 6c87 | - | https://www.sciencedirect.com/science/article/pii/S1878818119318249 | In silico and in vitro comparison of nicotinamide adenine dinucleotide phosphate dependent xylose reductase rossmaan fold in Debaryomycetaceae yeast family | 2020 | N Arumugam, T Boobalan, S Saravanan- Biocatalysis and, 2020 - Elsevier | it is the Integrated examinations of protein structure assessment online tool ID, Organism, Aa length, Rossmann fold region, Range, Identified PDB template, Hydrogen 3, MH286916, M. caribbica, 359, DFIDVVIVGAGFTKAVAAALLGVPGAGFVAVYDG, 330359, 6C87 , L20, A17, V16 |
| 3 | 3obk | - | http://pubs.acs.org/doi/abs/10.1021/jp304743c | Catalytic Mechanism of Porphobilinogen Synthase: The Chemical Step Revisited by QM/MM Calculations | 2012 | B Tian, E Erdtman, LA Eriksson - The Journal of Physical Chemistry, 2012 - ACS Publications | ... 2. Computational Details The crystal structures of the yeast PBGS-PBG* intermediate (PDB code 1OHL 7 ) and the Toxoplasma gondii PBGS-PBG complex (PDB code 3OBK 10 ) were obtained from the RCSB Protein Data Bank. Monomers of the two structures were used. ... |
| 4 | 5vm1 | - | https://onlinelibrary.wiley.com/doi/abs/10.1002/jobm.201800482 | Heterologous expression and biochemical characterization of a thermostable xylulose kinase from Bacillus coagulans IPE22 | 2019 | Y Zhang, C Zhao, Z Ni, M Shao, M Han- Journal of basic, 2019 - Wiley Online Library | was shown in Figure 1. In the 3D structure modeling analysis, Bc-XK showed the highest sequence identity of 35% with the homologue from Brucella ovis ATCC 25840 ( PDB accession number 5VM1 , DOI: 10.2210/pdb5VM1/ pdb ), the confi- dence and structure coverage values |
| 5 | 3nf4 | - | http://www.jbc.org/content/early/2017/08/02/jbc.M117.788513.short | Crystal structures of TdsC, a dibenzothiophene monooxygenase from the thermophile Paenibacillus sp. A11-2, reveal potential for expanding its substrate selectivity | 2017 | T Hino, H Hamamoto, H Suzuki, H Yagi - Journal of Biological , 2017 - ASBMB | ... replacement search models using MolRep (44). The polyalanine model from Mycobacterium thermoresistibile ( PDB ID: 3NF4 ) showed the highest score. After application of the ... All other structures were solved by molecular replacement of the apo-TdsC structure using ... |
| 6 | 4ol9 | - | http://pubs.acs.org/doi/abs/10.1021/acs.biochem.5b00174 | Evidence of kinetic cooperativity in dimeric ketopantoate reductase from Staphylococcus aureus. | 2015 | JE Sanchez, PG Gross, RW Goetze, RM Walsh… - Biochemistry, 2015 - ACS Publications | ... the dimeric assembly of S. aureus KPR is conserved in the enzymes from Ralstonia eutropha, Ralstonia solanacearum, Mycobacterium tuberculosis, Enterococcus faecalis, Methylococcus capsulatus, and Bacillus subtilis (PDB entries 3HWR, 3GHY, 4OL9, 2EW2, 3I83, and 3EGO, respectively), despite low sequence identity ranging from 20−31% ... |
| 7 | 4qhq | - | https://link.springer.com/protocol/10.1007/978-1-4939-8736-8_12 | Navigating Among Known Structures in Protein Space | 2019 | A Narunsky, N Ben-Tal, R Kolodny- Computational Methods in Protein, 2019 - Springer | evolutionary history, with sequences that diverged beyond the point where one can identify their common ancestry; for example, the SCOP fold, CATH Architecture , and ECOD As both neighbors ( pdb 4qhq and pdb 3qwl) have a bound methionine in their PDB structure (Fig |
| 8 | 6bfu | 6q04, 6nb3, 6q05, 6q07, 6nb4, 6nb7, 6q06 | https://www.biorxiv.org/content/10.1101/2020.07.16.207308v3.abstract | Systematic modeling of SARS-CoV-2 protein structures | 2020 | SI O'Donoghue, A Schafferhans, N Sikta, C Stolte- bioRxiv, 2020 - biorxiv.org | CoV, 82% identity, E = 10-24) with a fold not seen in any other PDB structure (CATH 3.40 from SARS-CoV-2, 98% identity, E = 10-44), all with beta barrel architecture (CATH 2.40 6acg from SARS-CoV, 77% identity, E = 10-321), of which one structure also showed |
| 9 | 4ege | - | http://www.sciencedirect.com/science/article/pii/S1570963916302278 | Crystal structure and biochemical investigations reveal novel mode of substrate selectivity and illuminate substrate inhibition and allostericity in a subfamily of Xaa-Pro | 2017 | VN Are, A Kumar, S Kumar, VD Goyal, B Ghosh - et Biophysica Acta (BBA , 2017 - Elsevier | ... are lacking with literature reports of either only structural data (PDB entries; 1WN1, 1WY2, 3Q6D,2IW2, 4EGE) or only ... for this was prepared by Chainsaw [26] using the XPDxc protein sequenceand the structure of a putative XPD from Thermococcus sibiricus (PDB: 4FKC) [8 ... |
| 10 | 3enk | - | http://www.sciencedirect.com/science/article/pii/S0944501313001407 | Functional characterization and transcriptional analysis of galE gene encoding a UDP-galactose 4-epimerase in Xanthomonas campestris pv. campestris | 2014 | CT Li, CT Liao, SC Du, YP Hsiao, HH Lo… - Microbiological …, 2014 - Elsevier | ... based on the detection of hydrogen bonds defined by an electrostatic criterion using the Dictionaryof Protein Secondary Structure database method obtained from PDBsum database. Thethree-dimensional structural model of Xcc GalE was based on E. coli GalE (PDB ID 1XEL ...B. pseudomallei (Bps-GalE, PDB code 3ENK); B. anthracis (Ban-GalE, PDB code 2C20); and T. thermophilus (Tth-GalE, PDB code 2P5U)... |