We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 6OJM | 2019 | 1 |
| 5IDS | 2016 | 1 |
| 5U4S | 2017 | 1 |
| 6O49 | 2020 | 1 |
| 6NCS | 2018 | 1 |
| 6N56 | 2018 | 1 |
| 6DUI | 2019 | 1 |
| 6XK2 | 2020 | 1 |
| 7JFN | 2020 | 1 |
| 5IDT | 2016 | 1 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 3qhd | 3P0Z, 3p0z | http://commons.lib.niu.edu/handle/10843/21551 | Design, synthesis, and evaluation of potential Burkholderia pseudomallei IspF inhibitors | 2019 | S Watkins - 2019 - commons.lib.niu.edu | xvi nOe Nuclear Overhauser enhancement/nuclear Overhauser effect PDB Protein Data Bank Pf Plasmodium falciparum ppm Parts per million RST Relative saturation transfer SAR Structure activity relationship SSGCID Seattle Structural Genomics Center for Infectious Disease ... It is possible the sp2 N of the imidazole is binding to the Zn2+, as seen in the crystal structures of 88 in BpIspF (3P0Z, 3QHD). |
| 2 | 3u0d | - | http://www.jbc.org/content/294/51/19523.short | The structure of the bacterial ironcatecholate transporter Fiu suggests that it imports substrates via a two-step mechanism | 2019 | R Grinter, T Lithgow- Journal of Biological Chemistry, 2019 - ASBMB | TBDTs are highly divergent in sequence but share a common structural architecture , consisting of a 22 The structure of Fiu consists of a 22-stranded transmembrane -barrel characteristic of the DALI web server (37) identified PiuA from Acinetobacter baumannii ( PDB code 5FP1 |
| 3 | 3uw3 | - | http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 | Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin | 2016 | P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com | A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ... |
| 4 | 5i1f | - | https://www.mdpi.com/1422-0067/21/1/280 | GTP Preference of d-Glycero--d-manno-Heptose-1-Phosphate Guanylyltransferase from Yersinia pseudotuberculosis | 2020 | S Kim, MS Kim, S Jo, DH Shin- International Journal of Molecular, 2020 - mdpi.com | 2). In the case of GalU from Burkholderia vietnamiensis (BvGalU, PDB ID: 5I1F ), there are two In contrast, some of AMPPN bound structures can be searched in the PDB ( PDB ID: 5KQ8 an induced-fit conformational change when they interact with GMPPN in the crystal structure |
| 5 | 3oj7 | - | http://scripts.iucr.org/cgi-bin/paper?rl5035 | Expression, purification, crystallization and preliminary X-ray crystallographic analysis of human histidine triad nucleotide-binding protein 2 (hHINT2) | 2013 | R Dolot, A Wlodarczyk, GD Bujacz? - Acta Crystallographica Section F Structural Biology and Crystallization Communications, 2013 - scripts.iucr.org | ... above 15% similarity to a given hHINT2 sequence and BALBES, and five of them were used for further calculations: PDB entries 1kpf ... 404, 627-638.] ), 3oj7 (HIT family protein from Entamoeba histolytica; 40.2% similarity; Seattle Structural Genomics Center for Infectious Disease ... |
| 6 | 3gmt | - | http://www.sciencedirect.com/science/article/pii/S2211546314000679 | Adenylate kinase from< i> Streptococcus pneumoniae</i> is essential for growth through its catalytic activity | 2014 | TT Thach, TT Luong, S Lee, DK Rhee - FEBS Open Bio, 2014 - Elsevier | ... Open, ligand-free SpAdK structure was solved by molecular replacement using PHENIX [35] with AdK from Marinibacillus marinus (PDB ID: 3FB4) and Burkholderia pseudomallei (PDB ID: 3GMT) as search models. ... |
| 7 | 4ed9 | - | http://dx.plos.org/10.1371/journal.pone.0067901 | Function and X-Ray crystal structure of Escherichia coli YfdE | 2013 | EA Mullins, KL Sullivan, TJ Kappock - PloS one, 2013 - dx.plos.org | ... the same orientation as Figure 4B. PDB entries are 4hl6 (white), 4ed9 (dark blue), 1p5h (green) [69], 1pt7 (cyan) [24], 3ubm (orange) [25], 1*k7 (yellow) [70], 1*74 (magenta) [71], and 2g04 (pink) [72]. (B) ML phylogram of the ... |
| 8 | 6x79 | - | https://www.biorxiv.org/content/10.1101/2021.05.06.441046v1.abstract | Structure-based design of a highly stable, covalently-linked SARS-CoV-2 spike trimer with improved structural properties and immunogenicity | 2021 | E Olmedillas, CJ Mann, W Peng, YT Wang, RD Avalos- bioRxiv, 2021 - biorxiv.org | For VFLIP_D614G, a population of 213,852 particles yielded a 2.8 resolution structure (Figure S2). Importantly, the density maps confirm Further sub-classification revealed an overall architecture that is similar to other closed spikes in the Protein Data Bank ( PDB ). ... A previously published structure of the SARS-CoV-2 ectodomain with all RBDs in the down conformation (PDB ID 6X79) was used to fit the cryo-EM maps in UCSF ChimeraX |
| 9 | 4dz4 | - | http://etheses.whiterose.ac.uk/id/eprint/20114 | Characterising two genomic islands involved in metabolism in Neisseria meningitidis | 2017 | AJ Chu - 2017 - etheses.whiterose.ac.uk | Figure 3.1-1 Simplified chemical structures of polyamines ----- 47 characterisation of the meningococcal pili structure demonstrates the organism's 135, X, Y, Z and 29E were duly classified based on structural variations in capsular |
| 10 | 4hjh | 3uw2 | http://www.sciencedirect.com/science/article/pii/S1876162317300366 | Biology, Mechanism, and Structure of Enzymes in the -d-Phosphohexomutase Superfamily | 2017 | KM Stiers, AG Muenks, LJ Beamer - in Protein Chemistry and Structural , 2017 - Elsevier | ... Enzymes in the α-d-phosphohexomutases superfamily catalyze the reversible conversion of phosphosugars, such as glucose 1-phosphate and glucose 6-phosphate. These reactions are fundamental to primary metabolism across the kingdoms of life and are required for a myriad of cellular processes, ... |