SSGCID
Seattle Structural Genomics Center for Infectious Disease

Cited Structures: list of articles citing SSGCID structures

We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.

This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.

Cited structures

Manually reviewed citations

# PDB Additional SSGCID structures cited Link Title Year Citation Highlighted abstract
1 5dvw - https://www.intechopen.com/online-first/docking-based-screening-of-cell-penetrat... Docking-Based Screening of Cell-Penetrating Peptides with Antiviral Features and Ebola Virus Proteins as a Drug Discovery Approach to Develop a 2021 E Raoufi, B Bahramimeimandi- Viral, 2021 - intechopen.com The potential reservoirs of EBOV RNA are three species of African fruit bats [3]. The genome of this virus contains a negative-strand RNA that encodes six structural and one non- structural proteins, which can be employed as potential drug targets, including transmembrane ... The structures of GP (PDBID: 5JQB), VP35 (PDBID: 3FKE), VP24 (PDBID: 4M0Q), VP30 (PDBID: 5DVW), VP40 (PDBID: 4LDB) and NP (PDBID: 4Z9P) proteins of EBOV were collected from Protein Data Bank
2 3gmt - http://www.sciencedirect.com/science/article/pii/S2211546314000679 Adenylate kinase from< i> Streptococcus pneumoniae</i> is essential for growth through its catalytic activity 2014 TT Thach, TT Luong, S Lee, DK Rhee - FEBS Open Bio, 2014 - Elsevier ... Open, ligand-free SpAdK structure was solved by molecular replacement using PHENIX [35] with AdK from Marinibacillus marinus (PDB ID: 3FB4) and Burkholderia pseudomallei (PDB ID: 3GMT) as search models. ...
3 3uw3 - http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin 2016 P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ...
4 4dz4 - http://etheses.whiterose.ac.uk/id/eprint/20114 Characterising two genomic islands involved in metabolism in Neisseria meningitidis 2017 AJ Chu - 2017 - etheses.whiterose.ac.uk Figure 3.1-1 Simplified chemical structures of polyamines ----- 47 characterisation of the meningococcal pili structure demonstrates the organism's 135, X, Y, Z and 29E were duly classified based on structural variations in capsular
5 5ucm - https://books.google.com/books?hl=en&lr=&id=0-L7DwAAQBAJ&oi=fnd&pg=PA69&dq=%225U... trans-Editing by aminoacyl-tRNA synthetase-like editing domains 2020 ABK Nagy, M Bakhtina- Biology of Aminoacyl, 2020 - books.google.com bound by an autonomous trans- editing factor, such as C. crescentus ProXp-ala ( PDB ID: 5VXB PheRS is also unique in its oligomeric structure it is a heterote- tramer domain ( bound in an editing active conformation will be needed to fully understand the structural basis for
6 3laa - https://www.sciencedirect.com/science/article/pii/S1047847719301728 Structure of the UspA1 protein fragment from Moraxella catarrhalis responsible for C3d binding 2019 KM Mikula, R Kolodziejczyk, A Goldman- Journal of structural biology, 2019 - Elsevier 2012) as found in SadA (2YO2, 2YNZ) (Hartmann et al., 2012) or BpaA ( 3LAA ) (Edwards et CCP4 package (Winn et al., 2011) with the structure of UspA1 165366 ( PDB : 3PR7) (Agnew Model of UspA1 299452 structure solved in this study, neck and coiled-coil domains; chain
7 3s99 - https://scripts.iucr.org/cgi-bin/paper?jb5014 The evolving story of AtzT, a periplasmic binding protein 2019 ML Dennis, L Esquirol, T Nebl, J Newman- Section D: Structural, 2019 - scripts.iucr.org (2019). D75, 9951002 Page 5. cluster protein and had electron density in the binding site for a purine. Post hoc analysis of the structure and sequence showed that PDB entry 3s99 has 54% sequence identity and an rmsd of 1.2A (over $330 residues) to AtzT
8 3gvh - https://mic.microbiologyresearch.org/content/journal/micro/10.1099/mic.0.000600 Analysis of the Mycoplasma bovis lactate dehydrogenase reveals typical enzymatic activity despite the presence of an atypical catalytic site motif 2018 Y Masukagami, KA Tivendale- , 2018 - mic.microbiologyresearch.org between MBOVPG45_0326 and the other bac- terial LDHs, and 2230 % identity across the region of align- ment between MBOVPG45_0326 and the other bacterial and parasitic MDHs in the PDB protein structure database 3GVH RCSB PDB Brucella melitensis LDH
9 3rr2 - http://onlinelibrary.wiley.com/doi/10.1111/febs.14273/full Structural characterization and functional analysis of cystathionine synthase: an enzyme involved in the reverse transsulfuration pathway of Bacillus anthracis 2017 S Devi, A Rehman, A Syed, KF Tarique- The FEBS, 2017 - Wiley Online Library Superposition of the BaCBS structure (purple) with the (A) human CBS ( PDB ID: 1M54), (B) PLP-bound OASS ( PDB ID: 2Q3B), and (C) PLP-unbound OASS ( PDB ID: 1O58) structures . (D) Structural superposition of BaCBS (purple) with PDB ID: 1OAS (yellow), PDB ID: 1VE1
10 4ed9 - http://dx.plos.org/10.1371/journal.pone.0067901 Function and X-Ray crystal structure of Escherichia coli YfdE 2013 EA Mullins, KL Sullivan, TJ Kappock - PloS one, 2013 - dx.plos.org ... the same orientation as Figure 4B. PDB entries are 4hl6 (white), 4ed9 (dark blue), 1p5h (green) [69], 1pt7 (cyan) [24], 3ubm (orange) [25], 1*k7 (yellow) [70], 1*74 (magenta) [71], and 2g04 (pink) [72]. (B) ML phylogram of the ...