We are actively tracking the number of publications by the scientific community which reference our structures, whether in the main text, figure captions or supplementary material. Selected articles are manually reviewed. Publications by SSGCID authors are excluded from the manually reviewed list. From our manual curation results, we estimate that the false positive rate might be as high as 50% for some structures.
This list was obtained from Google Scholar searches using an API provided by Christian Kreibich.
| Structure | Year released | #citations |
|---|---|---|
| 6BN2 | 2018 | 1 |
| 7KLI | 2020 | 1 |
| 3SLL | 2011 | 1 |
| 7N7S | 2021 | 1 |
| 5DB4 | 2016 | 1 |
| 6MAO | 2018 | 1 |
| 7LUY | 2021 | 1 |
| 6AR7 | 2017 | 1 |
| 6N1C | 2018 | 1 |
| 6MAI | 2018 | 1 |
| # | PDB | Additional SSGCID structures cited | Link | Title | Year | Citation | Highlighted abstract |
|---|---|---|---|---|---|---|---|
| 1 | 3meq | - | http://scripts.iucr.org/cgi-bin/paper?tt5041 | Structure of Escherichia coli AdhP (ethanol-inducible dehydrogenase) with bound NAD | 2013 | LM Thomas, AR Harper, WA Miner? - Acta Crystallographica Section F Structural Biology and Crystallization Communications, 2013 - scripts.iucr.org | ... 2007). J. Appl. Cryst. 40, 658-674.] ). The structure of Brucella melitensis alcohol dehydrogenase (PDB entry 3meq ; Seattle Structural Genomics Center for Infectious Disease, unpublished work) was used as the initial model. The ... |
| 2 | 4ot8 | - | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5958214/ | Chloroplastic serine hydroxymethyltransferase from Medicago truncatula: a structural characterization | 2018 | M Ruszkowski, B Sekula, A Ruszkowska- Frontiers in plant, 2018 - ncbi.nlm.nih.gov | It is very intriguing to see that, to our best knowledge, the conformation of the γ-hydroxyl group of PLP-Ser external aldimine is unique in comparison with nearly all other SHMT complexes in the PDB (PDB IDs: 1kkp, 1yjy, 2via, 2vmp, 2vmt, 2vmw, 2w7f, 2w7k, 4ot8), except for the alternative conformation (30% occupancy) in the E53Q mutant of Geobacillus |
| 3 | 6x79 | - | https://www.biorxiv.org/content/10.1101/2021.02.25.432861v3.abstract | Antiviral Resistance against Viral Mutation: Praxis and Policy for SARS CoV-2 | 2021 | RC Penner- BioRxiv, 2021 - biorxiv.org | E of rotations of BHBs in HQ60; Table 1, Protein Data Bank structure files upon The methods of this paper are im- plented online from an uploaded PDB file at et al., Hydrogen bond rotations as a uniform structural tool for analyzing protein architecture , Nature Communications, 5 |
| 4 | 3rr2 | - | http://onlinelibrary.wiley.com/doi/10.1111/febs.14273/full | Structural characterization and functional analysis of cystathionine synthase: an enzyme involved in the reverse transsulfuration pathway of Bacillus anthracis | 2017 | S Devi, A Rehman, A Syed, KF Tarique- The FEBS, 2017 - Wiley Online Library | Superposition of the BaCBS structure (purple) with the (A) human CBS ( PDB ID: 1M54), (B) PLP-bound OASS ( PDB ID: 2Q3B), and (C) PLP-unbound OASS ( PDB ID: 1O58) structures . (D) Structural superposition of BaCBS (purple) with PDB ID: 1OAS (yellow), PDB ID: 1VE1 |
| 5 | 3uw3 | - | http://www.ingentaconnect.com/content/ben/lddd/2016/00000013/00000003/art00011 | Molecular Docking and Dynamics Simulation of Vibrio anguillarum Aspartate Semialdehyde Dehydrogenase with Natural Product Caulerpin | 2016 | P Aiya Subramani, R Mahendran - Letters in Drug , 2016 - ingentaconnect.com | A MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK ... 7). Further structuralchar- acterisation needs to be done ... middle is due to an unfavourable secondary loop structure. ... |
| 6 | 3r20 | 3r8c | https://link.springer.com/article/10.1007/s13721-019-0191-7 | Homology modeling and in silico toxicity assessment of potential inhibitors of cytidylate kinase from Mycobacterium tuberculosis | 2019 | MA Isa- Network Modeling Analysis in Health Informatics and, 2019 - Springer | Six templates ( PDB CODE: 3R20 , 3R8C, 1Q3T, 1CKE, 2CMK, and 4E22) were selected based on the An alignment of the CMK and the 3R20 revealed that their structures share a 74.0 Ten structural models of CMK were generated, and the structure with the least DOPE and fold |
| 7 | 3dmp | - | http://www.sciencedirect.com/science/article/pii/S0141813016304482 | Unravelling the Potential of a New Uracil Phosphoribosyltransferase (UPRT) from Arabidopsis thaliana in Sensitizing HeLa Cells towards 5-Fluorouracil | 2016 | S Narayanan, P Sanpui, L Sahoo, SS Ghosh - International journal of , 2016 - Elsevier | ... UPRT templates from Protein Data Bank (PDB) PDB: 2EHJ (E. coli UPRT), PDB: 3DMP(Burkholderia pseudomallei UPRT) and PDB: 1BD4 (Toxoplasma gondii UPRT) were chosenfor generating the three ... 1). The three-dimensional structure of AtUPRT ( Fig. ... |
| 8 | 3gmt | - | http://www.sciencedirect.com/science/article/pii/S2211546314000679 | Adenylate kinase from< i> Streptococcus pneumoniae</i> is essential for growth through its catalytic activity | 2014 | TT Thach, TT Luong, S Lee, DK Rhee - FEBS Open Bio, 2014 - Elsevier | ... Open, ligand-free SpAdK structure was solved by molecular replacement using PHENIX [35] with AdK from Marinibacillus marinus (PDB ID: 3FB4) and Burkholderia pseudomallei (PDB ID: 3GMT) as search models. ... |
| 9 | 3quv | - | http://www.sciencedirect.com/science/article/pii/S1047847716300016 | Crystal structure of Rv2258c from Mycobacterium tuberculosis H37Rv, an S-adenosyl-l-methionine-dependent methyltransferase | 2016 | HN Im, HS Kim, DR An, JY Jang, J Kim, HJ Yoon - Journal of Structural , 2016 - Elsevier | ... (ii) nucleic acid MTases [Rv2118c (PDB: 1I9G; Gupta et al., 2001), Rv2372c (PDB: 4L69; Kumar et al., 2014), Rv2966c (PDB: 3P9N; Sharma et al., 2015), and MAB_3226c (PDB: 3QUV)] ... |
| 10 | 6c5v | - | https://books.google.com/books?hl=en&lr=&id=32CqDwAAQBAJ&oi=fnd&pg=PA313&dq=%226... | Gammaherpesvirus entry and fusion: A tale how two human pathogenic viruses enter their host cells | 2019 | BS Mhl, J Chen, R Longnecker- Adv. Virus Res, 2019 - books.google.com | 323 Gammaherpesvirus entry and fusion (Waterhouse et al., 2018) based on the crystal structures of EBV gB ( PDB ID: 3FVC), gH ( 6C5V ) and gL The structural sequence alignment of EBV and KSHV gB based on the crystal structure of EBV gB (3FVC)(Backovic et al., 2009 |